You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePurine nucleoside phosphorylase
Synonyms
  • PNP
  • Inosine phosphorylase
Gene NamePNP1
Enzyme Class
Biological Properties
General FunctionInvolved in purine-nucleoside phosphorylase activity
Specific FunctionCleavage of guanosine or inosine to respective bases and sugar-1-phosphate molecules
Cellular LocationNot Available
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
Purine metabolismec00230 Map00230
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
phosphate + 2'-DeoxyuridineUracil + 2-deoxy-D-ribofuranose 1-phosphate
Adenosine + phosphateRibose 1-phosphate + Adenine
phosphate + 2'-Deoxyadenosine2-deoxy-D-ribofuranose 1-phosphate + Adenine
2'-Deoxyguanosine + phosphate2-deoxy-D-ribofuranose 1-phosphate + Guanine
2'-Deoxyinosine + phosphateHypoxanthine + 2-deoxy-D-ribofuranose 1-phosphate
Metabolites
YMDB IDNameView
YMDB00032PurineShow
YMDB00058AdenosineShow
YMDB00061Ribose 1-phosphateShow
YMDB00098UracilShow
YMDB00263XanthineShow
YMDB005032'-DeoxyadenosineShow
YMDB005052'-DeoxyguanosineShow
YMDB00507ThymidineShow
YMDB005082'-DeoxyuridineShow
YMDB00509GuanosineShow
YMDB00510InosineShow
YMDB00511xanthosineShow
YMDB00555HypoxanthineShow
YMDB006592'-DeoxyinosineShow
YMDB006632-deoxy-D-ribofuranose 1-phosphateShow
YMDB00698GuanineShow
YMDB006999H-xanthineShow
YMDB00885ThymineShow
YMDB00887AdenineShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
purine-nucleoside phosphorylase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring pentosyl groups
Process
nucleoside metabolic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR209C
Gene Sequence>936 bp ATGAGTGATATCTTGAACGTAAGTCAACAACGTGAAGCAATTACCAAGGCCGCTGCGTAT ATTTCTGCTATTTTAGAACCACATTTCAAAAATACAACAAATTTCGAGCCTCCGAGAACT TTGATTATATGTGGTTCAGGGCTTGGTGGAATATCTACCAAGCTGTCTAGAGACAATCCA CCCCCGGTAACAGTCCCATACCAAGACATCCCAGGATTCAAGAAAAGTACGGTTCCAGGT CATTCCGGTACACTAATGTTCGGATCTATGAATGGTTCACCAGTAGTATTAATGAATGGT CGTCTTCATGGATATGAAGGCAACACATTGTTTGAGACTACTTTTCCTATTAGAGTGCTT AACCACATGGGTCATGTTCGTAATTTAATTGTCACTAATGCCGCTGGTGGTATAAACGCG AAATATCAAGCCTGCGATTTGATGTGCATTTATGATCATTTAAATATCCCTGGCCTTGCT GGCCAGCACCCATTGAGAGGTCCTAACTTGGATGAAGATGGACCTCGTTTTTTAGCCTTG AGTGATGCATATGATCTGGAGTTGAGGAAGCTTTTATTTAAGAAATGGAAAGAGCTCAAG ATTCAAAGGCCACTGCATGAAGGTACTTATACTTTTGTATCTGGACCCACTTTCGAAACA AGAGCAGAATCCAAAATGATAAGGATGTTGGGAGGAGATGCTGTCGGAATGAGTACTGTT CCCGAAGTCATTGTTGCAAGACATTGCGGATGGAGGGTTTTGGCCTTAAGTTTGATTACC AATACTTGCGTGGTGGATAGCCCTGCCAGTGCGTTGGACGAATCACCTGTACCCTTAGAA AAAGGCAAAGCGACTCACGCTGAAGTACTGGAGAATGGTAAAATCGCCTCTAATGACGTG CAAAACTTAATTGCTGCCGTAATGGGGGAATTATAA
Protein Properties
Pfam Domain Function
Protein Residues311
Protein Molecular Weight33754.60156
Protein Theoretical pI7.31
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Purine nucleoside phosphorylase MSDILNVSQQREAITKAAAYISAILEPHFKNTTNFEPPRTLIICGSGLGGISTKLSRDNP PPVTVPYQDIPGFKKSTVPGHSGTLMFGSMNGSPVVLMNGRLHGYEGNTLFETTFPIRVL NHMGHVRNLIVTNAAGGINAKYQACDLMCIYDHLNIPGLAGQHPLRGPNLDEDGPRFLAL SDAYDLELRKLLFKKWKELKIQRPLHEGTYTFVSGPTFETRAESKMIRMLGGDAVGMSTV PEVIVARHCGWRVLALSLITNTCVVDSPASALDESPVPLEKGKATHAEVLENGKIASNDV QNLIAAVMGEL
References
External Links
ResourceLink
Saccharomyces Genome Database PNP1
Uniprot IDQ05788
Uniprot NamePNPH_YEAST
GenBank Gene IDAY557950
Genebank Protein ID45269792
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956