You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHydroxyacylglutathione hydrolase, cytoplasmic isozyme
Synonyms
  • Glyoxalase II
  • Glx II
Gene NameGLO2
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionThiolesterase that catalyzes the hydrolysis of S-D- lactoyl-glutathione to form glutathione and D-lactic acid
Cellular LocationCytoplasm
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
S-Lactoylglutathione + waterGlutathione + D-Lactic acid
KEGG Reactions
S-Lactoylglutathione + waterGlutathione + hydron + D-Lactic acid
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
YMDB00246S-LactoylglutathioneShow
YMDB00287D-Lactic acidShow
YMDB00862hydronShow
YMDB00880S-D-LactoylglutathioneShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR272W
Gene Sequence>825 bp ATGCAGGTTAAATCGATTAAAATGAGATGGGAGTCTGGTGGTGTTAATTACTGCTATCTA TTGTCCGACAGTAAAAATAAAAAATCGTGGCTAATCGATCCAGCAGAGCCTCCTGAGGTT CTGCCAGAGTTGACTGAGGATGAGAAAATAAGTGTTGAAGCAATTGTTAATACACATCAC CATTATGACCATGCAGATGGTAACGCTGATATCTTGAAGTATTTAAAAGAGAAAAATCCA ACTTCAAAAGTTGAGGTTATAGGAGGGTCAAAGGACTGCCCAAAGGTTACGATAATTCCG GAGAATTTGAAAAAGTTACACCTAGGTGACTTAGAGATTACTTGTATTAGGACGCCCTGC CATACCAGAGACTCTATCTGTTATTATGTGAAAGATCCAACAACAGATGAGCGCTGCATT TTTACTGGCGATACACTATTTACCGCTGGTTGCGGTAGGTTTTTTGAGGGTACAGGCGAA GAAATGGATATAGCTCTGAACAATTCTATCTTAGAAACTGTGGGCAGGCAGAACTGGAGT AAAACGAGGGTTTATCCAGGACACGAATACACAAGTGATAATGTAAAGTTTGTTCGTAAG ATTTACCCGCAAGTTGGTGAAAATAAAGCATTGGATGAGTTAGAACAATTCTGCTCCAAG CATGAAGTCACAGCAGGGCGGTTCACTTTGAAAGATGAGGTAGAATTTAATCCATTCATG AGATTAGAAGATCCAAAGGTCCAAAAAGCTGCCGGAGATACGAATAATTCATGGGACAGA GCTCAAATTATGGATAAATTGAGAGCTATGAAAAACCGTATGTAG
Protein Properties
Pfam Domain Function
Protein Residues274
Protein Molecular Weight31326.30078
Protein Theoretical pI6.11
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Hydroxyacylglutathione hydrolase, cytoplasmic isozyme MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS KTRVYPGHEYTSDNVKFVRKIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPFM RLEDPKVQKAAGDTNNSWDRAQIMDKLRAMKNRM
References
External Links
ResourceLink
Saccharomyces Genome Database GLO2
Uniprot IDQ05584
Uniprot NameGLO2_YEAST
GenBank Gene IDU51030
Genebank Protein ID1230643
General Reference
  • Bito, A., Haider, M., Hadler, I., Breitenbach, M. (1997). "Identification and phenotypic analysis of two glyoxalase II encoding genes from Saccharomyces cerevisiae, GLO2 and GLO4, and intracellular localization of the corresponding proteins." J Biol Chem 272:21509-21519.9261170
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956