You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol monophosphatase 2
Synonyms
  • IMP 2
  • IMPase 2
  • Inositol-1(or 4)-monophosphatase 2
Gene NameINM2
Enzyme Class
Biological Properties
General FunctionInvolved in inositol or phosphatidylinositol phosphatase activity
Specific FunctionResponsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and involved in the inositol cycle of calcium signaling
Cellular LocationCytoplasmic
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB ReactionsNot Available
KEGG Reactions
1D-myo-inositol 1-phosphate + waterMyoinositol + phosphate
Metabolites
YMDB IDNameView
YMDB00173MyoinositolShow
YMDB007141D-myo-inositol 1-phosphateShow
YMDB00792Myo-inositol 1-phosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
inositol or phosphatidylinositol phosphatase activity
catalytic activity
hydrolase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR287W
Gene Sequence>879 bp ATGGTATTAACGAGGCAAGTACTAGAGGAAGTGGAGAACACATTTATTGAATTACTTAGG AGTAAAATAGGACCTCTCGTAAAATCGCACGCAGGAACAAACTTTTGTTCATATGATGAT AAAGCAAATGGCGTAGATTTGGTAACTGCTTTAGACAAACAAATTGAATCTATAATCAAG GAAAATTTAACGGCCAAGTATCCCAGTTTCAAATTTATCGGAGAAGAAACTTATGTAAAA GGTGTCACGAAAATAACTAACGGCCCTACATTTATTGTTGATCCCATCGATGGTACTACT AATTTTATTCACGGTTACCCCTATAGTTGTACATCTCTAGGTTTAGCTGAAATGGGGAAG CCGGTTGTTGGTGTGGTTTTCAATCCTCACTTAAACCAACTATTCCATGCTTCCAAAGGC AATGGAGCTTTCTTAAATGATCAGGAGATAAAGGTTTCAAAAAGGCCATTGATTTTGCAA AAATCCTTAATTGCTTTAGAAGGAGGTTCGGAAAGAACTGAAGGTTCCCAAGGAAACTTT GATAAGAAAATGAATACTTATAAAAACTTACTAAGTGAGTCCGGCGCCTTTGTTCACGGG TTCAGAAGTGCAGGAAGTGCTGCCATGAACATATGCTACGTAGCGAGCGGCATGCTTGAT GCTTATTGGGAAGGTGGCTGCTGGGCTTGGGATGTTTGTGCCGGTTGGTGTATTCTTGAG GAAGCAGGAGGAATAATGGTTGGCGGAAATTGTGGAGAATGGAACATTCCATTAGACAGA AGATGTTACTTGGCTATTAGAGGTGGATGTGAGTCGATGGAGCAGAAGCGATTTGCAGAA TCGTTTTGGCCTCACGTTGCGGGTGAGTTAGAATACTAA
Protein Properties
Pfam Domain Function
Protein Residues292
Protein Molecular Weight32092.40039
Protein Theoretical pI5.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol monophosphatase 2 MVLTRQVLEEVENTFIELLRSKIGPLVKSHAGTNFCSYDDKANGVDLVTALDKQIESIIK ENLTAKYPSFKFIGEETYVKGVTKITNGPTFIVDPIDGTTNFIHGYPYSCTSLGLAEMGK PVVGVVFNPHLNQLFHASKGNGAFLNDQEIKVSKRPLILQKSLIALEGGSERTEGSQGNF DKKMNTYKNLLSESGAFVHGFRSAGSAAMNICYVASGMLDAYWEGGCWAWDVCAGWCILE EAGGIMVGGNCGEWNIPLDRRCYLAIRGGCESMEQKRFAESFWPHVAGELEY
References
External Links
ResourceLink
Saccharomyces Genome Database INM2
Uniprot IDQ05533
Uniprot NameINM2_YEAST
GenBank Gene IDAY557746
Genebank Protein ID45269383
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Lopez, F., Leube, M., Gil-Mascarell, R., Navarro-Avino, J. P., Serrano, R. (1999). "The yeast inositol monophosphatase is a lithium- and sodium-sensitive enzyme encoded by a non-essential gene pair." Mol Microbiol 31:1255-1264.10096091
  • Navarro-Avino, J. P., Belles, J. M., Serrano, R. (2003). "Yeast inositol mono- and trisphosphate levels are modulated by inositol monophosphatase activity and nutrients." Biochem Biophys Res Commun 302:41-45.12593845