You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLysophospholipase NTE1
Synonyms
  • Intracellular phospholipase B
  • Neuropathy target esterase homolog
Gene NameNTE1
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionIntracellular phospholipase B that catalyzes the double deacylation of phosphatidylcholine (PC) to glycerophosphocholine (GroPCho). Plays an important role in membrane lipid homeostasis. Responsible for the rapid PC turnover in response to inositol, elevated temperatures, or when choline is present in the growth medium
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
Choline metabolismPW002494 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ERPW002532 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(10:0/10:0)PW002780 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(14:0/14:0)PW002783 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
PC(16:0/16:0) + waterGlycerophosphocholine + hydron + Palmitic acid
PC(14:0/0:0) + waterGlycerophosphocholine + a carboxylate
PC(16:0/0:0) + waterGlycerophosphocholine + a carboxylate
LysoPC(10:0) + waterGlycerophosphocholine + a carboxylate
PC(16:1(9Z)/0:0) + waterGlycerophosphocholine + a carboxylate
KEGG Reactions
fatty acid + hydron + Glycerophosphocholinewater + phosphatidylcholine
Metabolites
YMDB IDNameView
YMDB00069Palmitic acidShow
YMDB00309GlycerophosphocholineShow
YMDB00694sn-Glycero-3-phosphocholineShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB01175PC(14:0/0:0)Show
YMDB01179PC(16:0/0:0)Show
YMDB01180PC(16:0/16:0)Show
YMDB01184PC(16:1(9Z)/0:0)Show
YMDB01187PC(18:0/0:0)Show
YMDB01190PC(18:1(9Z)/0:0)Show
YMDB02213LysoPC(20:4(5Z,8Z,11Z,14Z))Show
YMDB16163LysoPC(10:0)Show
GO Classification
Component
organelle membrane
endoplasmic reticulum membrane
cell part
membrane
Function
carboxylesterase activity
catalytic activity
lysophospholipase activity
hydrolase activity
hydrolase activity, acting on ester bonds
Process
lipid metabolic process
organophosphate metabolic process
metabolic process
phospholipid metabolic process
glycerophospholipid metabolic process
primary metabolic process
phosphatidylcholine metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYML059C
Gene Sequence>5040 bp ATGCGTTCAATGAATTGCACTACGAACAACACCAACAATACCGGCCAAAACACGAAAAAC AGTCTTGGCTCCAGCTTTAATTCCAGTAATTATACTTCTTATAGATTCCAGACATGTCTC ACCGACCAGATTATTTCTGAGGCGCAGACGTGGTCACTTTCATCCCTCTTCAACTTCTCG TGGGTTGTGTCCTACTTTGTTATGGGTGCCTCTCGTATGATCTTCAGGTACGGTTGGTAT CTGGCAACTTTATCGCTTTTAAGGATTCCGAAGTGGATCTTCTTCAAGTTACACCATGTT CAGTTCACTCTTTCCTTTTGGCTGATCCTGTTTGCCCTAGCCGTCATAGTCTTTGTGACT TACACCATCATGAAGGAGAGAATTCTATCCCAGTACAAGAGGCTGACCCCGGAGTTCTTG CCGCTGGAAAATACAGGTAAATCTGGCTCCAGCGCCAATATCAATGCAGCTTCCACTCAG TCAGCCAACGCGCCACCCGCCATAGGTTCCTCTACCACGGGTGCAAGCTCGATTATAGAC TCAAAAAAGCATTCATTGAAAGATGGCAACGAAAACGAAACCTTTCTTTCATCTTACCTT GACCAATTTCTCAGCGCCATCAAAATCTTTGGCTATCTGGAAAAACCAGTCTTCCATGAC CTGACCAAGAATATGAAAACTCAAAAAATGGATGAGGGTGAGATTTTACTGTTGGACAGT ACTATTGGGTTTGCCATCGTCGTTGAAGGCACCCTGCAGTTATATCATGAAGTAGATCAT TCAGATAAGGACCATGGCGATGAAACTGACCACAGTGACACGGATGGTCTTGACGACCAG GATAGAGATGAAGAAGACGAAGAAGAAGATGATGACATTGATAACTACGACACCAAATCT TGTTCTTCTAACCTCATCGATGAAGAAGATGAATCCGTTGGTTACATTCATCTGAAAAAT GGACTGGGAAATTTTCAACTGCTAAATACAGTCAAGCCAGGAAACCCGCTGACCTCCCTC GTGAGCATTTTAAACTTATTCACGCATTCCATGTCCTCGTATGGCAACAGTAACTTTCCC TCTGAGTTATCGTCACCTATAGACACAACGGTGTCGGTCAACAATATGTTCTGCTCATCA GAGCAGAACTTCTCCAACACAGATTCCATGACAAACTCCACCAACAGCTTTCCAACGTTC CCCTCTTCAATGCCTAAACTTGTCGCCCGTGCGGCTACAGACTGCACAATTGGTATTATC CCACCTCAATCGTTTGCCAAATTAACCGCAAAATACCCACGGTCTGCTTCCCATATCATA CAGATGGTTCTCACCAAGCTATACCATGTTACGTTCCAAACTGCTCACGACTACTTAGGT TTAACAAAGGAGATCATGGATATCGAAGTTTTACTAAATAAATCCATCGTTTATGAATTG CCTTATTATTTGAAAGAGGCCGTTATTCGTAAGTTTAAAACTGTAGATAAGTCGAGCGGA TCGGCTGATTTAGAACCGAAACCCAAAAATAGTAATGCTTCCTCTAAATTGAAGAAACCG CCCAAAGCGAAGCCATCTGATGGTATCATTCAATCGCTTAAGATTGCTAACGCCAACGCT AACACAAGTTCGAATTCCCTTTCACTGAAACCAGAATTCACCCACCATCCAAGTTCGAGA CATGTCGTACTGGGTTCAAGAGACCAATTTAATCCTGGTGATTTACTGTCAAATGTCCCA CTGTCTAGAACTATGGATATTCTGTCACCCAACCCAATCCATAATAACAACCGCAATAAA TCAAACGGTATTAACACTTCTACCTCTAACCAACATAAGCGATCTTCTAGGAGTAGCAGT AACAATGCTTCCGTACACTCTAAGAAGTTTTCTTCTTTGTCCCCAGAATTGCGCAACGCA CAACTTAGTACATCGCCCTTGTCCTTGGATAATACTTCTGTTCATGACCATATCCACCCA AGTCCCGTTCATTTGAAGGGACGGGTCTCTCCAAGACCTAATTTACTGCCCACAACATCC TTTTCTGCTGCCCAGGAAGAAACCGAGGACTCTGCTTTAAGAATGGCTTTAGTTGAGGCA ATGTTAACATACTTGGGTGTAAACAAAAGCAATATGTCCGTTTCATCTTCTTCGATAGCA AATATGTCTTCTTTAAACTCTCCTCAACTTAATGAAATGTATAGCCGCCGTCCAAGTAAC GCAAGTTTTCTGATGTCCCCTCACTGTACACCATCTGACATTTCCGTAGCTTCATCATTT GCCTCTCCTCAAACTCAACCGACAATGTTAAGAATCCTACCCAAAGAATACACTATCAGC AATAAAAGGCATAATAAAAGTAAAAGCCAGGACAAAAAAAAACCTAGAGCTTACAAAGAG GAGTTGACACCCAATTTGGATTTCGAAGATGTCAAGAAAGACTTTGCACAAGGCATTCAG TTGAAGTTCTTTAAAAAGGGCACCACAATTGTTGAGCAGAACGCTCGTGGTAAAGGCCTA TTCTATATCATTTCCGGGAAAGTTAATGTGACAACAAATTCGTCCTCGTCAGTAGTATCA TCAATGTCTAAACCAGAGCAGGTTTCAGCCCAAAGTTCACACAAGGGTGAAAATCCTCAT CATACTCAACATTTGTTATACTCTGTAGGATCTGGTGGTATTGTGGGCTACTTGTCCTCT CTAATTGGTTACAAATCATTTGTTAATATCGTTGCCAAGAGCGATGTCTATGTTGGATTT TTATCTAGTGCAACCTTAGAAAGATTGTTTGATAAATATTTCCTAATCTACTTACGGATT TCTGATTCATTAACCAAATTGCTATCTTCAAGGTTATTAAAGCTCGACCATGCTTTAGAA TGGGTTCACTTGAGGGCTTCTGAAACTCTATTTTCACAAGGTGACTCGGCTAACGGTATT TATGTTGTCCTGAATGGTAGACTAAGGCAGCTACAACAGCAGTCATTGTCAAACTCCAAT ACAAGTTCCGAAGAAGTTGAAACTCAGAACATTATTCTAGGAGAACTGGCCCAGGGGGAG AGTTTTGGTGAAGTTGAAGTGCTTACCGCTATGAATAGATATTCAACGATAGTGGCAGTG AGGGATTCTGAATTAGCGAGAATTCCGAGAACATTATTCGAACTATTAGCTCTTGAACAT CCATCTATCATGATTAGAGTTTCCAGATTAGTTGCTAAAAAAATTGTCGGAGATAGAACT GTTCCAGCATTAACAGGCGATCCATTATCTATAAAGGAAAACGACTTCACTTCTTTAATA CCTCCAACGAAAGCGTCTTACTCTAGCTCTTTAAGTCATAAACCCCAAAATATTACTTCT GGCACAATTACTTTTAGAACCATCACTATCTTACCAATTACCAGTGGACTACCTGTAGAA GCATTTGCTATGAAGTTAGTGCAAGCTTTCAAACAGGTAGGAAGGACCACGATTGGTTTA AATCAAAGAACTACCCTAACACATTTAGGTCGTCATGCATTTGACAGATTGTCCAAATTA AAACAAAGTGGTTACTTTGCTGAACTAGAAGAAATGTACCAGACTGTTGTTTATATATCA GATACACCAGTTAAATCTAATTGGACAAGAACCTGTATTGCGCAAGGTGATTGTATTCTC TTACTAGCAGATGCTAGATCTCCATCAGCCGAAATAGGAGAATATGAAAAGTTATTACTA AATTCAAAGACTACCGCAAGGACCGAGTTAATTCTTCTACACCCTGAAAGGTATGTGGAA CCAGGACTAACCCATAAGTGGTTACGCTATAGGCCATGGGTTCATTCGCATCATCACATT CAATTTAGTTTGACAGGAACAACCTTGATGAACGAAGGCAAAATGCACGTTTTGAATAAT GGTGCCTTGGCATTAATGGATAAGTTGATTCAAACAGAATTCAGTAGAAAAACTCAACAG AATATATCAAAACTACTTCCAGATTCTATCAAGAACACCGTAGAAAACTTTTCTTCAAGA TTCATGAAAAGTAAAAGACAATATTACACACCAGTTCATAGGCATAAAAATGATTTTCTA AGATTGGCTAGAATTCTTTCTGGACAAGCTATTGGACTTGTCCTCGGAGGAGGAGGTGCG AGAGGTATTAGTCATTTGGGTGTCATTCAAGCTATTGAAGAACAAGGTATTCCGGTCGAC GTTATTGGAGGAACATCGATTGGTTCCTTTGTTGGCGGTTTGTACGCGAAGGATTATGAT TTGGTGCCAATTTACGGCCGCGTGAAGAAGTTTGCTGGTCGAATTTCCTCTATATGGAGA ATGTTAACAGATTTAACCTGGCCGGTTACTTCTTATACTACTGGTCACGAATTTAATAGA GGTATTTGGAAAACTTTCGGGGATACAAGAATTGAAGACTTCTGGATCCAGTATTATTGT AATTCTACTAATATAACCGATTCGGTTCAAGAAATACATTCCTTTGGTTATGCGTGGAGG TACATCAGAGCTTCGATGTCTCTTGCTGGTCTTTTACCTCCTTTGGAAGAGAACGGGTCT ATGTTACTGGATGGTGGTTATGTTGATAATTTACCAGTAACTGAGATGAGAGCGCGTGGT TGCCAAACTATATTTGCAGTAGATGTAGGTTCTGCAGATGATAGAACGCCTATGGAATAT GGTGACTCCCTAAATGGGTTTTGGATCATTTTCAATAGATGGAATCCATTTTCTTCTCAT CCAAACATACCCAATATGGCAGAGATTCAAGTTAGATTGGGTTACGTCGCATCAGTAAAT GCTTTAGAGAAAGCGAAAAATACACCAGGTGTCGTTTATGTGAGACCACCTATTGAAGAA TATGCCACATTAGACTTTAGCAAGTTCGAAGAAATTTATCATGTGGGTGTAGACTATGGT CGTATCTTTTTGCAAGGGCTTATTGACGACGACAAGATGCCATATATACCTGGTTCACAA GAAACCACTTTGAATTCTCAAGTTCCTGAGTTTTTATTACATAGAAGAAATAGTATTTGA
Protein Properties
Pfam Domain Function
Protein Residues1679
Protein Molecular Weight187131.0
Protein Theoretical pI8.24
Signalling Regions
  • None
Transmembrane Regions
  • 50-70
  • 104-124
Protein Sequence>Lysophospholipase NTE1 MRSMNCTTNNTNNTGQNTKNSLGSSFNSSNYTSYRFQTCLTDQIISEAQTWSLSSLFNFS WVVSYFVMGASRMIFRYGWYLATLSLLRIPKWIFFKLHHVQFTLSFWLILFALAVIVFVT YTIMKERILSQYKRLTPEFLPLENTGKSGSSANINAASTQSANAPPAIGSSTTGASSIID SKKHSLKDGNENETFLSSYLDQFLSAIKIFGYLEKPVFHDLTKNMKTQKMDEGEILLLDS TIGFAIVVEGTLQLYHEVDHSDKDHGDETDHSDTDGLDDQDRDEEDEEEDDDIDNYDTKS CSSNLIDEEDESVGYIHLKNGLGNFQLLNTVKPGNPLTSLVSILNLFTHSMSSYGNSNFP SELSSPIDTTVSVNNMFCSSEQNFSNTDSMTNSTNSFPTFPSSMPKLVARAATDCTIGII PPQSFAKLTAKYPRSASHIIQMVLTKLYHVTFQTAHDYLGLTKEIMDIEVLLNKSIVYEL PYYLKEAVIRKFKTVDKSSGSADLEPKPKNSNASSKLKKPPKAKPSDGIIQSLKIANANA NTSSNSLSLKPEFTHHPSSRHVVLGSRDQFNPGDLLSNVPLSRTMDILSPNPIHNNNRNK SNGINTSTSNQHKRSSRSSSNNASVHSKKFSSLSPELRNAQLSTSPLSLDNTSVHDHIHP SPVHLKGRVSPRPNLLPTTSFSAAQEETEDSALRMALVEAMLTYLGVNKSNMSVSSSSIA NMSSLNSPQLNEMYSRRPSNASFLMSPHCTPSDISVASSFASPQTQPTMLRILPKEYTIS NKRHNKSKSQDKKKPRAYKEELTPNLDFEDVKKDFAQGIQLKFFKKGTTIVEQNARGKGL FYIISGKVNVTTNSSSSVVSSMSKPEQVSAQSSHKGENPHHTQHLLYSVGSGGIVGYLSS LIGYKSFVNIVAKSDVYVGFLSSATLERLFDKYFLIYLRISDSLTKLLSSRLLKLDHALE WVHLRASETLFSQGDSANGIYVVLNGRLRQLQQQSLSNSNTSSEEVETQNIILGELAQGE SFGEVEVLTAMNRYSTIVAVRDSELARIPRTLFELLALEHPSIMIRVSRLVAKKIVGDRT VPALTGDPLSIKENDFTSLIPPTKASYSSSLSHKPQNITSGTITFRTITILPITSGLPVE AFAMKLVQAFKQVGRTTIGLNQRTTLTHLGRHAFDRLSKLKQSGYFAELEEMYQTVVYIS DTPVKSNWTRTCIAQGDCILLLADARSPSAEIGEYEKLLLNSKTTARTELILLHPERYVE PGLTHKWLRYRPWVHSHHHIQFSLTGTTLMNEGKMHVLNNGALALMDKLIQTEFSRKTQQ NISKLLPDSIKNTVENFSSRFMKSKRQYYTPVHRHKNDFLRLARILSGQAIGLVLGGGGA RGISHLGVIQAIEEQGIPVDVIGGTSIGSFVGGLYAKDYDLVPIYGRVKKFAGRISSIWR MLTDLTWPVTSYTTGHEFNRGIWKTFGDTRIEDFWIQYYCNSTNITDSVQEIHSFGYAWR YIRASMSLAGLLPPLEENGSMLLDGGYVDNLPVTEMRARGCQTIFAVDVGSADDRTPMEY GDSLNGFWIIFNRWNPFSSHPNIPNMAEIQVRLGYVASVNALEKAKNTPGVVYVRPPIEE YATLDFSKFEEIYHVGVDYGRIFLQGLIDDDKMPYIPGSQETTLNSQVPEFLLHRRNSI
References
External Links
ResourceLink
Saccharomyces Genome Database NTE1
Uniprot IDQ04958
Uniprot NameNTE1_YEAST
GenBank Gene IDZ46729
Genebank Protein ID577137
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Zaccheo, O., Dinsdale, D., Meacock, P. A., Glynn, P. (2004). "Neuropathy target esterase and its yeast homologue degrade phosphatidylcholine to glycerophosphocholine in living cells." J Biol Chem 279:24024-24033.15044461
  • Murray, J. P., McMaster, C. R. (2005). "Nte1p-mediated deacylation of phosphatidylcholine functionally interacts with Sec14p." J Biol Chem 280:8544-8552.15611060
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Gaspar, M. L., Aregullin, M. A., Jesch, S. A., Henry, S. A. (2006). "Inositol induces a profound alteration in the pattern and rate of synthesis and turnover of membrane lipids in Saccharomyces cerevisiae." J Biol Chem 281:22773-22785.16777854
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956