You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name1,3-beta-glucan synthase component FKS3
Synonyms
  • 1,3-beta-D-glucan-UDP glucosyltransferase
  • FK506 sensitivity protein 3
Gene NameFKS3
Enzyme Class
Biological Properties
General FunctionInvolved in 1,3-beta-D-glucan synthase activity
Specific FunctionRequired for spore wall assembly
Cellular LocationMitochondrion. Membrane; Multi-pass membrane protein (Potential)
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
1,3-beta-D-Glucan + Uridine 5'-diphosphateUridine diphosphate glucose + 1,3-beta-D-Glucan
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB163141,3-beta-D-GlucanShow
GO Classification
Component
cell part
membrane
macromolecular complex
1,3-beta-glucan synthase complex
protein complex
Function
UDP-glycosyltransferase activity
catalytic activity
UDP-glucosyltransferase activity
transferase activity
1,3-beta-glucan synthase activity
transferase activity, transferring glycosyl groups
Process
polysaccharide metabolic process
metabolic process
glucan metabolic process
cellular glucan metabolic process
beta-glucan metabolic process
primary metabolic process
1,3-beta-glucan metabolic process
carbohydrate metabolic process
1,3-beta-glucan biosynthetic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR306W
Gene Sequence>5358 bp ATGGATTTTATGAGTCCCAAGTTTTCGCTAACTGACGTTGAGTATCCTGCTTGGTGCCAA GACGATGAAGTCCCAATAACAATGCAGGAAATTAGAGAAATTTTTGTGGAGCTCATGGAT AAGTTTGGCTTCCAGAAATCTTCTATGGAAAATATGTATCAACATTTAATGGGACAGCTG GACTCCAGGGCAAGTCGTACAGGTGCTCAAAATGCTTTAGTATCGCTACATGTTTCATAT ATTGGAGGCGAACACGCAAATTATAGAAAATGGTATTTTGCCGCTCAGCTCGATTTAGAT GAAGAGATCGGGTTTCAAAACATGCGACTACATGGAAAGGCACGCCAAAGAAACGTAAAA ATGGCGAAGAAAAGAGGCGTATCGATAAAGGAACAAATTAAGCAATGGAATGAGAAGGAG CAAGAGTTCATCAATAACCATCCAAAGATCACACTGACTCAAGAACAATTGGAAGATCAG ACAAACTTGAAAAGTGCAGACTACAAATGGAAATTGAAAATGAAAAAATTGACGCCCGAA AATATGATAAGACAGCTGGCCCTTTATTTGCTTTGCTGGGGTGAAGCCAATCAAGTCAGA TTCGCCCCAGAATGCCTTTGCTTTATTTTCAAATGTGCACTTGATTATGATATTAGTACG TCAAGTAGCGAAAAAACGGTGAAATCACCTGAGTATTCATACTTAAATGACGTTATTACT CCCTTATACGAATTCCTAAGGGGCCAAGTATACAAAAAAGACGCAAAGGGGAACTGGAAA CGAAGAGAAAAAGACCACAAGAATATTATTGGTTACGACGACATCAATCAATTATTTTGG TACCCGGAAGGATTTGAACGTATTATTTTAAACAATGGAGAACGATTAGTTGACAAGCCA TTGGAGGAGAGATATCTTTACTTTAAAGACGTTGCATGGTCTAAAGTATTTTATAAGACA TATAGAGAAACCAGAAGTTGGAAGCATTGTTTTACCAATTTCAATAGATTCTGGATTATC CATTTTGCACCGTTTTGGTTCTTCACCACATTTAATTCCCCCACTTTGTACACCAAGAAT TATATACAGTTATTGAATAACCAGCCTACACCCCAAGTTAGACTATCAGTGATTGCCTTT GGAGGCACAATTGCATGTTTAGTTCAAATTTTAGCCACCGTGTTCGAGTGGGGATTTGTA CCTCGAGAATGGCCAGGCGCTCAGCATTTATCGAGTAGAATGATTGGCTTACTTTTTTGT CTTGCAATCAATTTGGGACCTTCCGTGTATGTTCTGGGGTTTTTCGAATGGGATGTTCAT TCAAAATCTGCGTATATCGTGTCCATCGTCCAACTAATCATTGCATTTTTAACCACTTTT TTTTTTGCTGTCAGACCTTTGGGCGGCTTATTTCGTCCATATTTGAATAAAGACAAAAAA CATCGGAGGTACATCTCATCGCAAACCTTTACCGCTTCATTTCCTAAGCTGACAGGACGC AGCAAATGGTTTTCTTATGGGTTATGGGTATTTGTGTATTTGGCGAAATATATTGAGTCC TATTTTTTTTTGACCTTGTCCCTCAGGGACCCCATCAGGGTCCTCTCTATTATGGATTTG TCCAGATGTCAAGGTGAATATTTGTTGGGTCCTATTCTATGTAAATGGCAAGCCAAAATT ACATTAGTTCTCATGCTGCTTTCTGACTTGGGCCTGTTTTTTCTCGACACTTACCTTTGG TACATTATTTGCAACTGTATTTTTTCCATTGTACTGTCATTTTCTCTTGGTACTTCAATT CTCACGCCATGGAAGAATGTATACTCTCGATTGCCAAAAAGGATATATTCCAAAATCCTT GCTACTTCAGAGATGGATGTAAAATTTAAAGCAAAAATACTGATATCGCAGGTTTGGAAT GCCATTGTTATATCAATGTATAGGGAACATCTTCTCTCCATTGAACATTTACAAAGACTC TTGTTTCAGCAAGTTGACTCCTTAATGGGAGACACAAGAACCCTGAAATCGCCTACATTT TTCGTTGCACAAGATGATTCAACGTTCAAGTCAATGGAATTTTTTCCATCAAATTCAGAG GCAAAAAGAAGGATATCCTTTTTTGCCCAATCCCTGGCGACCCCCATTTCAGAACCTGTT CCAGTGGATTGTATGCCAACTTTTACCGTTTTGGTACCCCATTATTCAGAAAAGATTCTG TTGGGCTTGAAGGAAATTATCAGGGAAGAATCTCCTAAAAGTAAAATCACGGTGCTTGAG TATTTGAAGCATCTACACCCTACAGAATGGGAATGTTTTGTTAAGGATACCAAACTACTA AGCATGGAAAAGAGCTTTTTGAAAGAGGCAGAGAGCAGTCATGATGAAGATAGATTGGAA ATTCCGGATGCTCTGTACGATCCAAGGTCTAGCCCGCTTTCTGACCATACTGAGTCCCGG AAGTTGCCCACAGAAGACGATCTTATTAAGGAGAAAATTAATGATTTGCCATTTTCTTAC TTTGGCTTCAACTCATCAGAACCATCGTACACCCTGAGAACAAGAATCTGGGCATCATTG CGGACGCAGACTTTGTACCGAACCCTTTCAGGGTTTATGAACTATTCCAAAGCTATTAAG CTACTGTATCGAATTGAAAACCCCTCTTTAGTTAGCTTGTATCGTGGCAATAATGAAGCA TTGGAGAATGACTTAGAAAATATGGCTAGCAGGAAATTTAGGATGGTTGTTGCTATGCAG AGATATGCAAAATTTAATAAGGATGAAGTGGAGGCAACAGAACTACTTTTAAGAGCCTAT CCAAATATGTTTATATCTTACCTTTTGGAAGAATTAGAGCAAAATGAATCTGAGAAAACG TACTATTCGTGCCTGACTAATGGCTATGCTGAGTTTGACGAAGAAAGTGGATTAAGGAAG CCAATATTCAAAATTCGCCTGTCGGGCAATCCAATACTTGGCGATGGAAAATCGGATAAT CAGAACCATTCTATTATATTTTATCGTGGTGAGTATATTCAGGTGATTGATGCAAACCAA GATAATTATTTGGAGGAATGCCTAAAGATACGGTCTGTTTTAAGTGAGTTCGAAGAGCTT GAGCTTAATCCCACAATCCCATACATTCCTGGCATTGAATATGAAGAAGAACCACCGCCC ATCGCTATTGTTGGTTCAAGAGAGTATATTTTTTCAGAAAATATTGGAGTGTTAGGTGAT ATTGCTGCAGGTAAAGAACAGACTTTTGGAACCTTATTTGCTAGAACGTTGGCTGAAATT GGTGGTAAATTGCACTATGGGCATCCCGATTTTCTCAATGGCATTTTTATGACCACTCGT GGTGGCCTGTCTAAGGCACAAAGAGGATTGCATTTAAACGAGGATATATATGCTGGAATG AACGCAATCTGCCGTGGTGGAAAGATAAAACATAGTGATTACTACCAATGTGGTAAGGGT AGAGATTTGGGATTTGGGTCCATCCTGAATTTCACTACTAAAATAGGTGCAGGTATGGGG GAACAGCTACTATCAAGGGAGTACTATTATTTGGGGACACAACTTCCCATGGATAGATTT TTATCGTTTTTTTATGCACATCCTGGTTTCCATCTGAATAATCTTTTTATTTCCTTTTCG GTTCAACTGTTCTTCGTTCTGCTTTTAAACTTGGGTGCGTTGAACCATGAAATTATAGCC TGCTTTTACGACAAGGATGCACCAATTACAAATCTTGAGACACCCGTTGGTTGTTATAAT ATTCAGCCTGCATTGCATTGGGTATCGATATTCGTACTATCAATCTTCATTGTTTTCTTT ATTGCCTTTGCCCCTTTGCTGATTCAAGAAGTTTTGGAAAAGGGTATTTGGAGAGCAGCT TCAAGGTTCCTACATCATCTTCTTTCAATGGCCCCATTATTTGAAGTATTCGTCTGCCAA GTTTATTCGAATTCTCTATTGATGGACTTGACCTTTGGGGGAGCAAAGTACATATCTACA GGTCGTGGGTTTGCAATAACACGCCTCGATTTTTTTACGCTCTATTCCAGATTTGTTAAT ATATCGATATATTCTGGTTTCCAAGTGTTCTTCATGTTATTATTCGCGATTATTTCCATG TGGCAACCCGCCTTATTATGGTTTTGGATTACAGTCATTTCGATGTGCTTCGCACCTTTT ATTTTCAATCCACATCAGTTCGCATTCATGGATTTCTTCATTGATTATAAAACCTTTATC CACTGGTTATTCTCAGGTAACACGAAATATCAAAAAGAATCGTGGGCAAACTTTGTCAAG AGTTCTCGATCAAGATTTACGGGCTATAAAAGTAAAACTGTAGATGATATTTCCGAAGAT TCAGGCCATGATTCAAAGAAAGCGAGGTTTTGGAACGTCTTCTTTGCAGAACTATTTCTA CCTTTCTGTGTGTTCCTCTTCAACTTCACCGCTTTTTCTTTCATTAATGCACAAACAGGG GTCTCTGACTCAACACCAACTAGCGCTGTTTTCCGTTTGTTGCTCGTAACTTTTTTGCCA ATCTTTCTTAACTCAATAGTGCTTTTTCTATTATTTTGGGTTTCACTTTTTGTGGTTCCT GGATTGTCATATTGTTGTAAAGACGCAGGTGCCGTGATTGCGTTTATTGCACACACTTTC TCGGTTTTGGTCTATCTTTTAGATTTCGAACTGATGTGGTTCTTACAAGGTTGGAACTTT ACCCGTACATTGATACTGCTTATTACGTGCATCAATATGCATCTGATTCTTTTCAAGGTC TTTACGACGATATTCTTGACAAGGGAGTATAAAAACAATAAGGCACATTTGGCATGGTGG AATGGTAAATGGTACAATACGGGCATGGGCTGGTCTATCATTTTACAGCCCATACGAGAA TACTTCGTGAAGATTATGGAATCTAGTTATTTTGCAGCAGATTTCTTTCTTGGTCACTTC CTCTTATTTATACAAACGCCCATAATATTGTTACCATTTATCGATTACTGGCATACAATG GTGCTATTTTGGATGAATCCAAGAAGTATTATCGCGCATAAAAGAATTTTGACTCGAAAG CAGAGAGCATTAAGAAGTAGGATAGTTTCAAAATATTTCTCTCTATATTTTGTGATGCTA GGTGTGCTCCTTTTTATGCTCATCGCGCCATTCTTTGCTGGTGATTTCGTATCTAGTCCG CAAGAATTGCTGGAAGGCACCCTTTTCGAAGGAATCTTCCAACCTAACAACCAAAACAAC AACGATACTGGTCCAAATGCTCCATCGACAATCCTGACTACAACACCAACTTTACCTACC TTTAGGACTGTCGCATAG
Protein Properties
Pfam Domain Function
Protein Residues1785
Protein Molecular Weight207481.0
Protein Theoretical pI8.17
Signalling Regions
  • None
Transmembrane Regions
  • 337-357
  • 375-395
  • 415-435
  • 444-464
  • 508-528
  • 547-567
  • 572-592
  • 712-732
  • 1215-1235
  • 1268-1288
  • 1303-1323
  • 1370-1390
  • 1394-1414
  • 1475-1495
  • 1514-1534
  • 1549-1569
  • 1585-1605
  • 1655-1675
  • 1713-1733
Protein Sequence>1,3-beta-glucan synthase component FKS3 MDFMSPKFSLTDVEYPAWCQDDEVPITMQEIREIFVELMDKFGFQKSSMENMYQHLMGQL DSRASRTGAQNALVSLHVSYIGGEHANYRKWYFAAQLDLDEEIGFQNMRLHGKARQRNVK MAKKRGVSIKEQIKQWNEKEQEFINNHPKITLTQEQLEDQTNLKSADYKWKLKMKKLTPE NMIRQLALYLLCWGEANQVRFAPECLCFIFKCALDYDISTSSSEKTVKSPEYSYLNDVIT PLYEFLRGQVYKKDAKGNWKRREKDHKNIIGYDDINQLFWYPEGFERIILNNGERLVDKP LEERYLYFKDVAWSKVFYKTYRETRSWKHCFTNFNRFWIIHFAPFWFFTTFNSPTLYTKN YIQLLNNQPTPQVRLSVIAFGGTIACLVQILATVFEWGFVPREWPGAQHLSSRMIGLLFC LAINLGPSVYVLGFFEWDVHSKSAYIVSIVQLIIAFLTTFFFAVRPLGGLFRPYLNKDKK HRRYISSQTFTASFPKLTGRSKWFSYGLWVFVYLAKYIESYFFLTLSLRDPIRVLSIMDL SRCQGEYLLGPILCKWQAKITLVLMLLSDLGLFFLDTYLWYIICNCIFSIVLSFSLGTSI LTPWKNVYSRLPKRIYSKILATSEMDVKFKAKILISQVWNAIVISMYREHLLSIEHLQRL LFQQVDSLMGDTRTLKSPTFFVAQDDSTFKSMEFFPSNSEAKRRISFFAQSLATPISEPV PVDCMPTFTVLVPHYSEKILLGLKEIIREESPKSKITVLEYLKHLHPTEWECFVKDTKLL SMEKSFLKEAESSHDEDRLEIPDALYDPRSSPLSDHTESRKLPTEDDLIKEKINDLPFSY FGFNSSEPSYTLRTRIWASLRTQTLYRTLSGFMNYSKAIKLLYRIENPSLVSLYRGNNEA LENDLENMASRKFRMVVAMQRYAKFNKDEVEATELLLRAYPNMFISYLLEELEQNESEKT YYSCLTNGYAEFDEESGLRKPIFKIRLSGNPILGDGKSDNQNHSIIFYRGEYIQVIDANQ DNYLEECLKIRSVLSEFEELELNPTIPYIPGIEYEEEPPPIAIVGSREYIFSENIGVLGD IAAGKEQTFGTLFARTLAEIGGKLHYGHPDFLNGIFMTTRGGLSKAQRGLHLNEDIYAGM NAICRGGKIKHSDYYQCGKGRDLGFGSILNFTTKIGAGMGEQLLSREYYYLGTQLPMDRF LSFFYAHPGFHLNNLFISFSVQLFFVLLLNLGALNHEIIACFYDKDAPITNLETPVGCYN IQPALHWVSIFVLSIFIVFFIAFAPLLIQEVLEKGIWRAASRFLHHLLSMAPLFEVFVCQ VYSNSLLMDLTFGGAKYISTGRGFAITRLDFFTLYSRFVNISIYSGFQVFFMLLFAIISM WQPALLWFWITVISMCFAPFIFNPHQFAFMDFFIDYKTFIHWLFSGNTKYQKESWANFVK SSRSRFTGYKSKTVDDISEDSGHDSKKARFWNVFFAELFLPFCVFLFNFTAFSFINAQTG VSDSTPTSAVFRLLLVTFLPIFLNSIVLFLLFWVSLFVVPGLSYCCKDAGAVIAFIAHTF SVLVYLLDFELMWFLQGWNFTRTLILLITCINMHLILFKVFTTIFLTREYKNNKAHLAWW NGKWYNTGMGWSIILQPIREYFVKIMESSYFAADFFLGHFLLFIQTPIILLPFIDYWHTM VLFWMNPRSIIAHKRILTRKQRALRSRIVSKYFSLYFVMLGVLLFMLIAPFFAGDFVSSP QELLEGTLFEGIFQPNNQNNNDTGPNAPSTILTTTPTLPTFRTVA
References
External Links
ResourceLink
Saccharomyces Genome Database FKS3
Uniprot IDQ04952
Uniprot NameFKS3_YEAST
GenBank Gene IDZ49212
Genebank Protein ID798948
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961
  • Ishihara, S., Hirata, A., Nogami, S., Beauvais, A., Latge, J. P., Ohya, Y. (2007). "Homologous subunits of 1,3-beta-glucan synthase are important for spore wall assembly in Saccharomyces cerevisiae." Eukaryot Cell 6:143-156.17158736
  • Kung, L. A., Tao, S. C., Qian, J., Smith, M. G., Snyder, M., Zhu, H. (2009). "Global analysis of the glycoproteome in Saccharomyces cerevisiae reveals new roles for protein glycosylation in eukaryotes." Mol Syst Biol 5:308.19756047