You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutathione S-transferase omega-like 3
SynonymsNot Available
Gene NameGTO3
Enzyme Class
Biological Properties
General FunctionPosttranslational modification, protein turnover, chaperones
Specific FunctionActive as '1-Cys' thiol transferase against beta- hydroxyethyl disulfide (HED), as dehydroascorbate reductase and as dimethylarsinic acid reductase, while not active against the standard GST substrate 1-chloro-2,4-dinitrobenzene (CDNB)
Cellular LocationCytoplasm
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 13
LocusYMR251W
Gene Sequence>1101 bp ATGTCTGAAAAATCAGCTAGCAATAACAAAGCTGAATTCAAAAGGCAGTCATCGCCATTC AGAGAAATCATCTCTGCGGATCACCCAATTTATAAACCTGCTAAGGGAAGGTACTGGCTG TATGTGGCGCTACCATGCCCATGGGCACAAAGAACCTTGATCACCAGGGCCCTGAAAGGG CTAGCGCCTATAATCGGGTGCAGTGTAGCGCATTGGCACCTGGATGACAAAGGCTGGCGA TTCCTTGAAGAAGGAGATGGGAAAACCAATGAAAGGCACTGGTTTGACATTGCAGGCGGA ATTAGCTCAGTAAATTTAAATACCAGTACTCCTGTGGCTAACATACCCAATAACGCGCAT CGGTTGTTGGTCGACGGAACAGATGAACCGCATTACGGGTACAAGAGACTAAGCGACTTC TATTTCAAAACAAAGCCAGACTATAAGGGAAGATTCACCGTACCTGTTCTTTGGGACTTG GAAACATGCACTATAGTAAACAATGAAAGCAGTGATATCATCGGAATTATGAATTCCGCT GCGTTTGATGAGTTTGTCGGCGAAGAATACCGTCAAGTCCGTCTGGTACCTCGGTCTCTA GAGGCACAGATTACAGAGTTCAACTCTTGGGTGTACGATAAAATCAACAACGGTGTATAC AAGGCCGGTTTTGCAGAATGTGCAGAGGTATACGAGAGGGAGGTAACAAGCCTTTTTCAA TATCTTGACAAATTGGAAAATCTTCTGGACAAGAAGTACACAGATTTGGAGGCGGAGTAT GGTAAGAACAACAAGGACAAGATACTAGATCGCTACTTTGCCATCGGAGACACTCTGACC GAGGCGGACGTGAGACTCTACCCAACGATAGTAAGGTTCGACGTGGTATACCATCAACAC TTCAAATGCAATCTGGCCACCATCAGAGATGATTATTCCCGTATACACACGTGGCTCAAG AATATATACTGGCGCCACGAAGCCTTCCAGCGCACAACGGACTTTACCCACATAAAACTC GGATATACTCGCTCGCAGCCACGGGTCAACCCGATTGGGATCACCCCACTGGGGCCCAAG CCTGATATCCGACCTCCATGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues366
Protein Molecular Weight42402.60156
Protein Theoretical pI7.63
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutathione S-transferase omega-like 3 MSEKSASNNKAEFKRQSSPFREIISADHPIYKPAKGRYWLYVALPCPWAQRTLITRALKG LAPIIGCSVAHWHLDDKGWRFLEEGDGKTNERHWFDIAGGISSVNLNTSTPVANIPNNAH RLLVDGTDEPHYGYKRLSDFYFKTKPDYKGRFTVPVLWDLETCTIVNNESSDIIGIMNSA AFDEFVGEEYRQVRLVPRSLEAQITEFNSWVYDKINNGVYKAGFAECAEVYEREVTSLFQ YLDKLENLLDKKYTDLEAEYGKNNKDKILDRYFAIGDTLTEADVRLYPTIVRFDVVYHQH FKCNLATIRDDYSRIHTWLKNIYWRHEAFQRTTDFTHIKLGYTRSQPRVNPIGITPLGPK PDIRPP
References
External Links
ResourceLink
Saccharomyces Genome Database GTO3
Uniprot IDQ04806
Uniprot NameGTO3_YEAST
GenBank Gene IDAY692580
Genebank Protein ID51012611
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Garcera, A., Barreto, L., Piedrafita, L., Tamarit, J., Herrero, E. (2006). "Saccharomyces cerevisiae cells have three Omega class glutathione S-transferases acting as 1-Cys thiol transferases." Biochem J 398:187-196.16709151
  • Barreto, L., Garcera, A., Jansson, K., Sunnerhagen, P., Herrero, E. (2006). "A peroxisomal glutathione transferase of Saccharomyces cerevisiae is functionally related to sulfur amino acid metabolism." Eukaryot Cell 5:1748-1759.16936141