You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutamate decarboxylase
Synonyms
  • GAD
Gene NameGAD1
Enzyme Class
Biological Properties
General FunctionInvolved in glutamate decarboxylase activity
Specific FunctionL-glutamate = 4-aminobutanoate + CO(2)
Cellular LocationNot Available
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
Taurine and hypotaurine biosynthesisPW002480 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Butanoate metabolismec00650 Map00650
Taurine and hypotaurine metabolismec00430 Map00430
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
L-Glutamic acid + hydronCarbon dioxide + 4-(Glutamylamino) butanoate
3-SulfinoalanineHypotaurine + Carbon dioxide
Cysteic acidTaurine + Carbon dioxide
L-Aspartic acid + hydron Carbon dioxide + Beta-Alanine
KEGG Reactions
L-Glutamic acid + hydronCarbon dioxide + gamma-Aminobutyric acid
Metabolites
YMDB IDNameView
YMDB00195Beta-AlanineShow
YMDB00271L-Glutamic acidShow
YMDB00335gamma-Aminobutyric acidShow
YMDB00772TaurineShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
YMDB00912Carbon dioxideShow
YMDB16125HypotaurineShow
YMDB161263-SulfinoalanineShow
YMDB16152Cysteic acidShow
YMDB162334-(Glutamylamino) butanoateShow
GO Classification
Component
Not Available
Function
pyridoxal phosphate binding
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
glutamate decarboxylase activity
binding
catalytic activity
cofactor binding
Process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
glutamate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR250W
Gene Sequence>1758 bp ATGTTACACAGGCACGGTTCTAAGCAGAAGAACTTCGAGAATATCGCTGGAAAAGTTGTC CACGACCTTGCAGGTCTGCAATTGCTTTCTAACGACGTTCAAAAATCCGCTGTCCAAAGT GGTCATCAAGGATCGAACAATATGAGAGATACTTCGTCTCAGGGCATGGCTAATAAGTAT TCAGTTCCAAAAAAGGGACTACCTGCTGATTTGTCTTACCAACTGATTCATAATGAATTA ACACTTGATGGTAATCCGCATTTGAACCTTGCCAGTTTCGTGAACACTTTTACCACTGAT CAGGCAAGGAAATTGATTGATGAAAATTTGACCAAAAATCTTGCTGACAATGATGAATAT CCGCAATTAATTGAGCTAACTCAGCGTTGTATTTCTATGCTAGCTCAATTATGGCACGCT AATCCCGATGAAGAACCAATAGGCTGTGCCACCACAGGTTCTAGTGAGGCAATCATGTTG GGTGGACTCGCCATGAAAAAAAGATGGGAACACAGAATGAAGAATGCTGGTAAAGATGCT TCCAAGCCGAACATTATAATGTCTTCTGCGTGCCAAGTGGCATTAGAGAAGTTTACGAGA TATTTTGAAGTGGAATGCCGATTGGTTCCGGTATCCCACAGAAGCCATCATATGCTTGAC CCAGAGTCGTTATGGGATTATGTAGATGAGAACACTATTGGCTGTTTTGTAATTTTAGGA ACCACCTACACTGGCCATTTGGAAAATGTAGAGAAAGTTGCAGATGTCTTGTCCCAAATT GAGGCCAAGCATCCTGATTGGAGCAATACTGATATTCCAATCCATGCGGATGGCGCTTCA GGTGGGTTTATTATCCCATTTGGCTTTGAAAAAGAGCACATGAAAGCTTATGGCATGGAA CGTTGGGGGTTCAACCATCCGCGTGTGGTTAGTATGAACACTAGTGGTCATAAGTTTGGC TTAACCACTCCCGGTCTGGGTTGGGTGCTATGGAGAGATGAATCCTTACTGGCTGATGAA TTGAGATTCAAACTAAAGTACCTCGGTGGCGTGGAAGAAACTTTCGGTTTGAATTTTTCA AGACCTGGATTTCAAGTTGTCCATCAATACTTCAATTTTGTTTCTCTAGGCCATTCAGGG TATAGAACACAATTCCAAAATTCTCTATTTGTTGCAAGAGCGTTTTCTTTCGAATTATTG AATTCGTCAAAATTGCCCGGATGCTTTGAAATTGTTAGCAGTATCCATGAAAGCATTGAG AACGATTCCGCCCCTAAGTCAGTTAAAGACTATTGGGAACACCCCCAGGCTTACAAACCA GGTGTACCGCTGGTAGCCTTCAAATTGTCCAAGAAATTCCACGAAGAATATCCAGAAGTG CCACAAGCAATCCTTTCCTCTTTACTGAGAGGTAGGGGTTGGATAATACCAAATTACCCA CTACCAAAGGCAACGGATGGATCCGATGAGAAGGAGGTATTAAGAGTGGTTTTCAGATCG GAGATGAAGTTGGATTTAGCACAGTTGTTGATCGTTGACATCGAGAGTATCTTGACAAAG TTGATTCATAGTTACGAAAAGGTTTGTCATCATATAGAACTTGCCTCTGAGCAAACTCCA GAGCGCAAGAGTTCGTTCATCTACGAAATGTTGCTGGCATTGGCATCTCCACAAGATGAC ATCCCAACGCCGGATGAAATCGAAAAGAAAAATAAGCTAAAGGAAACAACAACGAGAAAC TATAGAGGAACATGTTGA
Protein Properties
Pfam Domain Function
Protein Residues585
Protein Molecular Weight65989.5
Protein Theoretical pI6.61
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutamate decarboxylase MLHRHGSKQKNFENIAGKVVHDLAGLQLLSNDVQKSAVQSGHQGSNNMRDTSSQGMANKY SVPKKGLPADLSYQLIHNELTLDGNPHLNLASFVNTFTTDQARKLIDENLTKNLADNDEY PQLIELTQRCISMLAQLWHANPDEEPIGCATTGSSEAIMLGGLAMKKRWEHRMKNAGKDA SKPNIIMSSACQVALEKFTRYFEVECRLVPVSHRSHHMLDPESLWDYVDENTIGCFVILG TTYTGHLENVEKVADVLSQIEAKHPDWSNTDIPIHADGASGGFIIPFGFEKEHMKAYGME RWGFNHPRVVSMNTSGHKFGLTTPGLGWVLWRDESLLADELRFKLKYLGGVEETFGLNFS RPGFQVVHQYFNFVSLGHSGYRTQFQNSLFVARAFSFELLNSSKLPGCFEIVSSIHESIE NDSAPKSVKDYWEHPQAYKPGVPLVAFKLSKKFHEEYPEVPQAILSSLLRGRGWIIPNYP LPKATDGSDEKEVLRVVFRSEMKLDLAQLLIVDIESILTKLIHSYEKVCHHIELASEQTP ERKSSFIYEMLLALASPQDDIPTPDEIEKKNKLKETTTRNYRGTC
References
External Links
ResourceLink
Saccharomyces Genome Database GAD1
Uniprot IDQ04792
Uniprot NameDCE_YEAST
GenBank Gene IDZ48639
Genebank Protein ID732928
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956