You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePantothenate kinase
Synonyms
  • Pantothenic acid kinase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in pantothenate kinase activity
Specific FunctionPlays a role in the physiological regulation of the intracellular CoA concentration
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
Pantothenic acid + Adenosine triphosphate D-4'-Phosphopantothenate + ADP + hydron
Pantothenic acid + Adenosine triphosphateADP + hydron + D-4'-Phosphopantothenate
KEGG Reactions
Adenosine triphosphate + (R)-Pantothenic acidD-4'-Phosphopantothenate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00203(R)-Pantothenic acidShow
YMDB00272D-4'-PhosphopantothenateShow
YMDB00749(R)-4'-phosphopantothenic acidShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB01522Pantothenic acidShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
catalytic activity
transferase activity
pantothenate kinase activity
transferase activity, transferring phosphorus-containing groups
Process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
coenzyme A biosynthetic process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYDR531W
Gene Sequence>1104 bp ATGCCGCGAATTACTCAAGAGATATCTTACAATTGCGATTATGGCGACAATACTTTCAAC CTTGCTATTGATATAGGAGGCACTCTGGCTAAAGTAGTCTTCTCGCCTATACACAGTAAC AGGCTGATGTTCTACACCATTGAAACAGAGAAAATTGACAAGTTCATGGAACTTCTGCAT TCTATTATCAAAGAACATAACAATGGATGCTATAGAATGACTCATATAATTGCCACTGGT GGTGGCGCCTTCAAGTTTTATGATTTGTTGTATGAAAATTTTCCTCAAATAAAAGGTATA TCGAGGTTCGAAGAAATGGAAGGCTTAATTCACGGTTTAGACTTTTTCATTCATGAGATT CCCGATGAAGTTTTCACTTACAACGATCAAGATGGCGAAAGGATAATACCCACCAGTTCC GGCACCATGGACTCAAAGGCTATCTACCCATACCTTCTAGTCAATATAGGGTCGGGTGTC TCAATATTAAAAGTCACCGAACCAAACAATTTTAGTAGAGTAGGCGGTTCTTCACTGGGA GGAGGAACTCTTTGGGGCCTATTATCACTAATTACTGGCGCTCAAACTTATGATCAGATG CTCGATTGGGCACAAGAGGGTGACAATTCTAGCGTTGATATGCTAGTTGGAGATATTTAT GGAACAGACTATAATAAAATTGGTCTAAAGTCGTCAGCTATTGCAAGTTCATTTGGTAAA GTTTTCCAAAATAGAATGACATCTAACAAATCTTTGGAAAACAACGAAAATAAATTATAT TCCTCACATGAGTCTATTGAGAAAAACAATGGACAAATGTTTAAGAATCCTGATATTTGT AAAAGTCTTCTATTCGCCATCTCCAACAATATTGGGCAAATAGCTTATTTGCAAGCTAAA ATCAATAATATACAGAATATATACTTTGGCGGATCTTATACCAGAGGACATTTGACTACC ATGAACACTTTGAGCTACGCTATTAATTTTTGGTCACAAGGATCAAAGCAAGCGTTTTTT CTCAAACATGAAGGCTATTTGGGTGCAATGGGTGCTTTCCTAAGCGCGTCTCGTCATTCA TCTACTAAGAAAACAAGTACGTAG
Protein Properties
Pfam Domain Function
Protein Residues367
Protein Molecular Weight40902.89844
Protein Theoretical pI6.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pantothenate kinase MPRITQEISYNCDYGDNTFNLAIDIGGTLAKVVFSPIHSNRLMFYTIETEKIDKFMELLH SIIKEHNNGCYRMTHIIATGGGAFKFYDLLYENFPQIKGISRFEEMEGLIHGLDFFIHEI PDEVFTYNDQDGERIIPTSSGTMDSKAIYPYLLVNIGSGVSILKVTEPNNFSRVGGSSLG GGTLWGLLSLITGAQTYDQMLDWAQEGDNSSVDMLVGDIYGTDYNKIGLKSSAIASSFGK VFQNRMTSNKSLENNENKLYSSHESIEKNNGQMFKNPDICKSLLFAISNNIGQIAYLQAK INNIQNIYFGGSYTRGHLTTMNTLSYAINFWSQGSKQAFFLKHEGYLGAMGAFLSASRHS STKKTST
References
External Links
ResourceLink
Saccharomyces Genome Database YDR531W
Uniprot IDQ04430
Uniprot NamePANK_YEAST
GenBank Gene IDU33057
Genebank Protein ID927798
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106