You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePantothenate kinase
Synonyms
  • Pantothenic acid kinase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in pantothenate kinase activity
Specific FunctionPlays a role in the physiological regulation of the intracellular CoA concentration
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
Pantothenic acid + Adenosine triphosphate D-4'-Phosphopantothenate + ADP + hydron
Pantothenic acid + Adenosine triphosphateADP + hydron + D-4'-Phosphopantothenate
KEGG Reactions
Adenosine triphosphate + (R)-Pantothenic acidD-4'-Phosphopantothenate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00203(R)-Pantothenic acidShow
YMDB00272D-4'-PhosphopantothenateShow
YMDB00749(R)-4'-phosphopantothenic acidShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB01522Pantothenic acidShow
GO Classification
Component
Not Available
Function
adenyl ribonucleotide binding
catalytic activity
ATP binding
transferase activity
kinase activity
transferase activity, transferring phosphorus-containing groups
binding
pantothenate kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
Process
metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
cellular metabolic process
coenzyme A biosynthetic process
Gene Properties
Chromosome LocationNot Available
LocusYDR531W
Gene Sequence>1104 bp ATGCCGCGAATTACTCAAGAGATATCTTACAATTGCGATTATGGCGACAATACTTTCAAC CTTGCTATTGATATAGGAGGCACTCTGGCTAAAGTAGTCTTCTCGCCTATACACAGTAAC AGGCTGATGTTCTACACCATTGAAACAGAGAAAATTGACAAGTTCATGGAACTTCTGCAT TCTATTATCAAAGAACATAACAATGGATGCTATAGAATGACTCATATAATTGCCACTGGT GGTGGCGCCTTCAAGTTTTATGATTTGTTGTATGAAAATTTTCCTCAAATAAAAGGTATA TCGAGGTTCGAAGAAATGGAAGGCTTAATTCACGGTTTAGACTTTTTCATTCATGAGATT CCCGATGAAGTTTTCACTTACAACGATCAAGATGGCGAAAGGATAATACCCACCAGTTCC GGCACCATGGACTCAAAGGCTATCTACCCATACCTTCTAGTCAATATAGGGTCGGGTGTC TCAATATTAAAAGTCACCGAACCAAACAATTTTAGTAGAGTAGGCGGTTCTTCACTGGGA GGAGGAACTCTTTGGGGCCTATTATCACTAATTACTGGCGCTCAAACTTATGATCAGATG CTCGATTGGGCACAAGAGGGTGACAATTCTAGCGTTGATATGCTAGTTGGAGATATTTAT GGAACAGACTATAATAAAATTGGTCTAAAGTCGTCAGCTATTGCAAGTTCATTTGGTAAA GTTTTCCAAAATAGAATGACATCTAACAAATCTTTGGAAAACAACGAAAATAAATTATAT TCCTCACATGAGTCTATTGAGAAAAACAATGGACAAATGTTTAAGAATCCTGATATTTGT AAAAGTCTTCTATTCGCCATCTCCAACAATATTGGGCAAATAGCTTATTTGCAAGCTAAA ATCAATAATATACAGAATATATACTTTGGCGGATCTTATACCAGAGGACATTTGACTACC ATGAACACTTTGAGCTACGCTATTAATTTTTGGTCACAAGGATCAAAGCAAGCGTTTTTT CTCAAACATGAAGGCTATTTGGGTGCAATGGGTGCTTTCCTAAGCGCGTCTCGTCATTCA TCTACTAAGAAAACAAGTACGTAG
Protein Properties
Pfam Domain Function
Protein Residues367
Protein Molecular Weight40902.89844
Protein Theoretical pI6.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pantothenate kinase MPRITQEISYNCDYGDNTFNLAIDIGGTLAKVVFSPIHSNRLMFYTIETEKIDKFMELLH SIIKEHNNGCYRMTHIIATGGGAFKFYDLLYENFPQIKGISRFEEMEGLIHGLDFFIHEI PDEVFTYNDQDGERIIPTSSGTMDSKAIYPYLLVNIGSGVSILKVTEPNNFSRVGGSSLG GGTLWGLLSLITGAQTYDQMLDWAQEGDNSSVDMLVGDIYGTDYNKIGLKSSAIASSFGK VFQNRMTSNKSLENNENKLYSSHESIEKNNGQMFKNPDICKSLLFAISNNIGQIAYLQAK INNIQNIYFGGSYTRGHLTTMNTLSYAINFWSQGSKQAFFLKHEGYLGAMGAFLSASRHS STKKTST
References
External Links
ResourceLink
Saccharomyces Genome Database YDR531W
Uniprot IDQ04430
Uniprot NamePANK_YEAST
GenBank Gene IDU33057
Genebank Protein ID927798
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106