You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHypoxanthine-guanine phosphoribosyltransferase
Synonyms
  • HGPRT
  • HGPRTase
  • Bypass of repression by adenine protein 6
Gene NameHPT1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleoside metabolic process
Specific FunctionIMP + diphosphate = hypoxanthine + 5-phospho- alpha-D-ribose 1-diphosphate
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Phosphoribosyl pyrophosphate + GuaninePyrophosphate + Guanosine monophosphate
Hypoxanthine + Phosphoribosyl pyrophosphatePyrophosphate + Inosinic acid
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00352Inosinic acidShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00555HypoxanthineShow
YMDB00698GuanineShow
GO Classification
Component
Not Available
Function
Not Available
Process
nucleoside metabolic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR399W
Gene Sequence>666 bp ATGTCGGCAAACGATAAGCAATACATCTCGTACAACAACGTACATCAACTATGTCAAGTA TCCGCTGAGAGAATTAAGAATTTCAAGCCGGACTTAATCATTGCCATTGGTGGTGGTGGT TTCATTCCTGCTAGGATCCTACGTACGTTCCTAAAGGAGCCCGGCGTGCCAACCATCAGA ATTTTTGCTATTATTTTGTCTTTGTACGAAGATTTGAACAGTGTAGGCTCAGAAGTTGAG GAAGTTGGTGTTAAGGTTAGCAGAACACAATGGATTGATTACGAGCAATGTAAATTAGAT CTAGTCGGCAAGAACGTTCTTATCGTTGACGAAGTCGATGACACCCGTACCACACTTCAT TACGCTTTGAGTGAATTGGAAAAGGATGCAGCTGAACAGGCAAAGGCTAAAGGTATCGAT ACTGAAAAGTCTCCAGAGATGAAAACAAACTTCGGGATTTTTGTTCTACACGATAAGCAA AAACCAAAGAAAGCAGATTTGCCTGCCGAAATGTTGAATGACAAGAACCGTTATTTTGCA GCTAAAACTGTTCCAGACAAGTGGTATGCATATCCATGGGAATCTACTGACATTGTTTTC CATACTAGAATGGCTATTGAACAGGGCAATGACATCTTTATTCCTGAGCAGGAACACAAG CAATGA
Protein Properties
Pfam Domain Function
Protein Residues221
Protein Molecular Weight25190.5
Protein Theoretical pI5.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Hypoxanthine-guanine phosphoribosyltransferase MSANDKQYISYNNVHQLCQVSAERIKNFKPDLIIAIGGGGFIPARILRTFLKEPGVPTIR IFAIILSLYEDLNSVGSEVEEVGVKVSRTQWIDYEQCKLDLVGKNVLIVDEVDDTRTTLH YALSELEKDAAEQAKAKGIDTEKSPEMKTNFGIFVLHDKQKPKKADLPAEMLNDKNRYFA AKTVPDKWYAYPWESTDIVFHTRMAIEQGNDIFIPEQEHKQ
References
External Links
ResourceLink
Saccharomyces Genome Database HPT1
Uniprot IDQ04178
Uniprot NameHPRT_YEAST
GenBank Gene IDU32274
Genebank Protein ID927331
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Schmidt, R., Wiegand, H., Reichert, U. (1979). "Purification and characterization of the hypoxanthine-guanine phosphoribosyltransferase from Saccharomyces cerevisiae." Eur J Biochem 93:355-361.371963
  • Nussbaum, R. L., Caskey, C. T. (1981). "Purification and characterization of hypoxanthine-guanine phosphoribosyltransferase from Saccharomyces cerevisiae." Biochemistry 20:4584-4590.6170313
  • Ali, L. Z., Sloan, D. L. (1982). "Studies of the kinetic mechanism of hypoxanthine-guanine phosphoribosyltransferase from yeast." J Biol Chem 257:1149-1155.7035445
  • Woods, R. A., Roberts, D. G., Stein, D. S., Filpula, D. (1984). "Adenine phosphoribosyltransferase mutants in Saccharomyces cerevisiae." J Gen Microbiol 130:2629-2637.6392474
  • Guetsova, M. L., Lecoq, K., Daignan-Fornier, B. (1997). "The isolation and characterization of Saccharomyces cerevisiae mutants that constitutively express purine biosynthetic genes." Genetics 147:383-397.9335580
  • Escobar-Henriques, M., Daignan-Fornier, B. (2001). "Transcriptional regulation of the yeast gmp synthesis pathway by its end products." J Biol Chem 276:1523-1530.11035032
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106