You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRiboflavin kinase
Synonyms
  • Flavin mononucleotide kinase 1
Gene NameFMN1
Enzyme Class
Biological Properties
General FunctionInvolved in riboflavin kinase activity
Specific FunctionCatalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN) coenzyme
Cellular LocationMicrosome. Mitochondrion inner membrane. Endoplasmic reticulum (Potential).
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
Adenosine triphosphate + RiboflavinADP + Flavin Mononucleotide
KEGG Reactions
Riboflavin + Adenosine triphosphateFlavin Mononucleotide + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00085Flavin MononucleotideShow
YMDB00109Adenosine triphosphateShow
YMDB00534RiboflavinShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
kinase activity
riboflavin kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
nitrogen compound metabolic process
riboflavin metabolic process
riboflavin biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR236C
Gene Sequence>657 bp ATGTTTACGTGGACTATTTATGTTTCGTTATTGCTAGTGTTAGCAGGTACTTTCTTAATG AACCGAAATACGAATACAGATATAATTGATACTTTTAAACGAGAAGTCGATTTGCCAATA CCTGCGCAACCAGGTCCACCATTCCCGCTTGTTACTGACTATTGTGACATTGTATGTGGA TTTGGCCGCGGATCCGCCGAATTGGGTATTCCCACTGCCAATGTACCTATAAATCAGTTA CCTAAAGGTATCAACGATTTGGATTTAGGGGTTTACTTTGGGTTTGCTCACATTAAAACT GTTGATGGTCAAGAACTATCGGTGGAAACAAGGCGGGATGGAAGAACTGTGGTTTATAAT TACGGTCAATATTTAAGTGAAGCGAACGATGATTTGTCCGTACTTCCTATGGTACTTTCA GTTGGGAAAAATCCATTCTACGGAAATGATTTCAAAACCATGGAATTACATATTATACAT GATTTTAAAAATGATTTTTATGGGGCCAGGGTCAAGTTCAATATTTTAGGTCATATCAGA CCCGAATTGAACTACACTACTAAGGAAGCTCTGATCGAAGACATCAATATCGATATTAGG ACTGCGCAGACTGTCCTTGCCACTCCACCGTATCAAGTATTCAAACAACAATTATAG
Protein Properties
Pfam Domain Function
Protein Residues218
Protein Molecular Weight24536.90039
Protein Theoretical pI4.84
Signalling Regions
  • 1-19
Transmembrane Regions
  • None
Protein Sequence>Riboflavin kinase MFTWTIYVSLLLVLAGTFLMNRNTNTDIIDTFKREVDLPIPAQPGPPFPLVTDYCDIVCG FGRGSAELGIPTANVPINQLPKGINDLDLGVYFGFAHIKTVDGQELSVETRRDGRTVVYN YGQYLSEANDDLSVLPMVLSVGKNPFYGNDFKTMELHIIHDFKNDFYGARVKFNILGHIR PELNYTTKEALIEDINIDIRTAQTVLATPPYQVFKQQL
References
External Links
ResourceLink
Saccharomyces Genome Database FMN1
Uniprot IDQ03778
Uniprot NameRIFK_YEAST
GenBank Gene IDAY557733
Genebank Protein ID45269357
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Santos, M. A., Jimenez, A., Revuelta, J. L. (2000). "Molecular characterization of FMN1, the structural gene for the monofunctional flavokinase of Saccharomyces cerevisiae." J Biol Chem 275:28618-28624.10887197
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956