Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEthanolamine kinase
Synonyms
  • EK
Gene NameEKI1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, alcohol group as acceptor
Specific FunctionCatalyzes the committed step of phosphatidylethanolamine synthesis via the CDP-ethanolamine pathway. Also exhibits choline kinase activity but its preferred substrate is ethanolamine
Cellular LocationNot Available
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Ethanolamine + Adenosine triphosphateADP + hydron + O-Phosphoethanolamine
KEGG Reactions
Adenosine triphosphate + Ethanolaminehydron + ADP + O-Phosphoethanolamine
Metabolites
YMDB IDNameView
YMDB00009EthanolamineShow
YMDB00109Adenosine triphosphateShow
YMDB00125O-PhosphoethanolamineShow
YMDB00862hydronShow
YMDB00914ADPShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR147W
Gene Sequence>1605 bp ATGTACACCAATTATTCACTTACAAGCAGTGACGCAATGCCCCGAACTTACTTGGTCGGC ACAGCCTCACCAGAAATGTCTAAGAAAAAGCGCCAGTCTGCAAATTGTGACAAGCCAACG AGGAGGGTGATCCACATCATCGATACTAATGAGCACTCAGAAGTCGACTTGAAAAATGAA CTGCCAATAACATGCACGAATGAAGACGGTGAGATGACATCAAGCTCATGGACTTCACAA ACCGCTAATGATTTTCTCAAACTGGCATACGTAAACGCGAAATTAGACCCGTCTTTGCCA TCTCAATATTTCAAACAAGATATCATAAATGTTTTACAAAGCTTGGAGATTCCTGGATGG TCTGTGCCCGGCTCTAAAGAATCCTCGTTGAATAAGAATTTATTAACTTTGACACAAATC AAGGGGGCCCTTACAAATGTTATTTATAAGATTCACTATCCAAACTTACCCCCTTTACTG ATGAGAATTTTTGGTGATAGCATAGATTCTGTAATTGATAGAGAGTATGAATTAAAGGTT ATTGCGAGATTATCATTTTATGATTTAGGACCCAAACTAGAAGGGTTTTTTGAAAATGGC AGATTTGAAAAATACATTGAGGGTTCGAGGACATCTACTCAAGCCGACTTTATAGATCGG GATACTTCAATAAAAATTGCTAAAAAATTGAAAGAGTTGCATTGTACTGTTCCATTAACG CATAAAGAAATAACGGATCAACCGTCATGCTGGACAACCTTTGATCAGTGGATCAAATTA ATAGACTCGCATAAAGAGTGGGTTTCCAATAATGTAAATATAAGTGAAAATTTACGCTGT TCAAGTTGGAATTTTTTTTTAAAGAGTTTCAAAAATTATAAGCGTTGGTTGTATAATGAT TCTGCTTTTACCTCAAAATTATTAAGAGAGGATGATAAAGATAGTATGATAAATTCTGGG CTAAAAATGGTATTTTGCCATAACGACTTACAGCATGGTAATTTACTTTTTAAAAGTAAG GGTAAGGATGACATCTCAGTGGGCGATTTAACAATTATTGACTTTGAGTACGCAGGCCCT AACCCCGTTGTATTTGATTTATCAAATCATTTGAATGAATGGATGCAAGACTATAATGAT GTGCAGTCTTTCAAGTCTCATATTGATAAGTATCCAAAAGAAGAAGATATTTTAGTTTTT GCACAAAGTTATATAAATCACATGAATGAGAACCATGTCAAAATTGCTTCTCAAGAGGTT AGGATTCTTTACAATCTAATCATCGAATGGAGGCCTTGTACACAATTATTCTGGTGCCTT TGGGCTCTTTTGCAAAGCGGAAGGCTACCACAACGACCACTGATAGAAGGTGAAAAACTA ATGAGCGAAAAGGCTGGACTAGGTGATGAAACGCACCTTATGGAGCACAAAAATAAAGAG AATGGAAAATACGATTGTTCTGAAGATGATTCGTTCAACTATTTAGGATTTTGTAAAGAA AAAATGTCTGTCTTTTGGGGCGATTTAATTACATTGGGAGTTATCGACAAAGACTGCCCA GATATTGGAAAAACAGATTACTTAGACACTAAACTTATTTTTTAA
Protein Properties
Pfam Domain Function
Protein Residues534
Protein Molecular Weight61656.39844
Protein Theoretical pI5.64
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ethanolamine kinase MYTNYSLTSSDAMPRTYLVGTASPEMSKKKRQSANCDKPTRRVIHIIDTNEHSEVDLKNE LPITCTNEDGEMTSSSWTSQTANDFLKLAYVNAKLDPSLPSQYFKQDIINVLQSLEIPGW SVPGSKESSLNKNLLTLTQIKGALTNVIYKIHYPNLPPLLMRIFGDSIDSVIDREYELKV IARLSFYDLGPKLEGFFENGRFEKYIEGSRTSTQADFIDRDTSIKIAKKLKELHCTVPLT HKEITDQPSCWTTFDQWIKLIDSHKEWVSNNVNISENLRCSSWNFFLKSFKNYKRWLYND SAFTSKLLREDDKDSMINSGLKMVFCHNDLQHGNLLFKSKGKDDISVGDLTIIDFEYAGP NPVVFDLSNHLNEWMQDYNDVQSFKSHIDKYPKEEDILVFAQSYINHMNENHVKIASQEV RILYNLIIEWRPCTQLFWCLWALLQSGRLPQRPLIEGEKLMSEKAGLGDETHLMEHKNKE NGKYDCSEDDSFNYLGFCKEKMSVFWGDLITLGVIDKDCPDIGKTDYLDTKLIF
References
External Links
ResourceLink
Saccharomyces Genome Database EKI1
Uniprot IDQ03764
Uniprot NameEKI1_YEAST
GenBank Gene IDZ50046
Genebank Protein ID899397
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Kim, K., Kim, K. H., Storey, M. K., Voelker, D. R., Carman, G. M. (1999). "Isolation and characterization of the Saccharomyces cerevisiae EKI1 gene encoding ethanolamine kinase." J Biol Chem 274:14857-14866.10329685
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956