You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerophosphodiester phosphodiesterase GDE1
SynonymsNot Available
Gene NameGDE1
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionGlycerophosphocholine glycerophosphodiesterase responsible for the hydrolysis of intracellular glycerophosphocholine into glycerol-phosphate and choline. The choline is used for phosphatidyl-choline synthesis. Required for utilization of glycerophosphocholine as phosphate source
Cellular LocationCytoplasm
SMPDB Pathways
Choline metabolismPW002494 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ERPW002532 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(10:0/10:0)PW002780 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(14:0/14:0)PW002783 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Glycerophosphocholine + waterhydron + Glycerol 3-phosphate + Choline
Glycerophosphocholine + waterEthanol + Choline
KEGG Reactions
water + GlycerophosphocholineGlycerol 3-phosphate + Choline + hydron
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00227CholineShow
YMDB00309GlycerophosphocholineShow
YMDB00694sn-Glycero-3-phosphocholineShow
YMDB00862hydronShow
YMDB00883EthanolShow
YMDB00890waterShow
YMDB00988sn-glycerol 3-phosphateShow
GO Classification
Component
Not Available
Function
lipase activity
hydrolase activity
phospholipase activity
hydrolase activity, acting on ester bonds
phospholipase C activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
glycerophosphodiester phosphodiesterase activity
catalytic activity
Process
small molecule metabolic process
lipid metabolic process
alcohol metabolic process
polyol metabolic process
alditol metabolic process
glycerol metabolic process
metabolic process
signaling
signaling pathway
primary metabolic process
intracellular signaling pathway
Gene Properties
Chromosome Locationchromosome 16
LocusYPL110C
Gene Sequence>3672 bp ATGAAGTTCGGAAAAACCTTTGCCAATCATCGCATTCCAGAGTGGTCAAGTCAATATGTT GGCTACAAGTCGTTGAAGAAAATGATTAAAGAAATTACAAGACTTCAAGAAGACATATAT AGGGCACATAACAAGAATAGCTATGATGAAGGCAGGCCACCAACAAAAATGAGAGATTCA TCTAATAGTGCTCAAAATTATTTGGACTCTCCAAAAATCCAAAAGTTATTGGCGTCGTTT TTCTTTGCAGTTGACAGGGATATTGAGAAGGTTGATACATTTTACAATTCCCAGTATGCG GAATATAAGAAAAGATTTGAGAGATTGCTTTCTTCTAATCAATTCAATGAGATAAAATCA ACATTAGTGGTCGATGCCAACAAAGAAGATGCAGTAGCGCAAACCTTACTCACAAAGGAT ACGAGAGAGATGAATATGCTTTTAAAGGGAACAAGTCAAGCCAGCCGTCTATCTTACCAT AAAGATGACTTAATTGAAATTCAGTCTATCTTAGCTGAGTTAAGAAAACAATTTAGAAAC TTAAAGTGGTACGCTGAACTAAATAAGAGAGCTTTTGGTAAGATTTTAAAGAAACTGGAT AAAAAAGTCGGCACAAATCAGCAAATGTCAACTATGAAAACTAGAATCTTGCCGTTACAA TTTGCTAATGATTCTCTTATTACCAAAGATTTGAGTTTGCTAAAAACTATCTGGGAACAA GTGACGTTCAGGATAAATTCTTACGAGAGAGTAATGAGGAGTACCTCGCCGAACGCAAAT GCTAATGATAATACAGAATTCTTTAAGATTATTTGCGTTTTTATAGAAGAAGATGATAGC AAAGGATTGATTAGAGAGCTAACAAACCTATATTCGGAATTGTCTTTGATTCCAACAAGA ATTATGATAAGTGTTTTAAACAAGGCAGCACTGTCTAAATCACTGGCATGTATTGATGCT ATCTTAAAGGTTATTCCGTCTCTAAATGACTCGGAAGATATTAACAGAAGAAATTTTTTC CATCATCACATAATTGCAATCGGGAAGTTAATCAGAAAACAGGAAATTTTAAGTAGGAAA AAGAAGTCACAACCCTCAAAATATACTAATAGTGAGGGAGAAATTGTAACAGATTTAAGA ACCCTGCATACGACCCTATCTGCCCCGGCAGAATCAGATAGCATTACAGAGGAGGAAAAA AGTTCGGCCTGTACACTCTCTTATATTTTAGAGGAGTTACCAATTCATTTAAGACCATGC CTTTTTCAGCATGATAATTACAAGAGAACGCCCTTGCATTATTCTTGCCAGTATGGCTTA TCTGAAGTTACGAAGTTGATTATCAAGTTAATGAAAGAATGGAATATCTGGAATGAAATC CCTATTGATGACGTTTCCGCGTTCGGAGATGCCGAATCATTGACACCTTTACATTTATGT GTGTTGGGTGCTCATCCCAAAACAACAGAAGTCTTATTGCAATCTTTGGATCCGAACGTG AAATTAAAAAGTTCAAGTTTGTTACATTTGGCCACTGAGTGGAATAACTATCCCCTTTTA CATGTTCTCCTATCATCAAAAAGGTTTGATATTAATTATCAAGACAACGAATTACATGAA ACACCGCTATATCTTGCTTGTAGATTAAATTTTTTCGAAGCTGCTGTGTGTTTGTTGTAC AATGGAGCCGACCTTGAAATAAGAGAAAAACTTTTTGGCTGGACAGCTATCTTCGTTGCA GCAGCAGAAGGGTTTACGGACATTGTAAAGCTCTTGATAGCCAACAACGCGAACTTTGAT ATTGAAGATGAAGGTGGGTGGACGCCGATGGAGCACGCGGTATTGCGCGGTCATTTGCAC ATTGCTGATATGGTTCAAATCAGAGACGAACTGGTCACGCATCCCCATTCACAGTTGAAC AGTGGTAGCGAAGAGAAAGAACCACTAAACGAAATTAGTGCCGGAGAATTAAATGAGAGA AATGAAAATGGAAACGGAGGTAATAAAGGGTCCTTGGGAAAACTGGCCGGACCAATAAAG TCATATGGACACAGATTCCTGGATAATAATGAATCACTTATACTAATAACATTGGGAAGT AATGACACAAGAAACAAAAGCCCTTCAATTTCATTAAGCTCGGAAGCACTAGCAAAAGTT ATTGGGTTGGAAACAGATTGTGCATTATCGTTAGTAATTTCATGCAATGATTCAATTGAT AAATCTTCTGTAATCTTAGATTTACCATTAGATGATAATGTGGACGCAGTAGACTTCAAA GTGCCTTTCAAAGTTGATTATTCTCATACATTATATTTTGATATTGTGCCAACATATGGA ACACGCTCGTTGGAGACCCATAATAGAATAGATTGTCAAAAAAATAACAATAATTACGTA ATGGCAAGGGGTGTTTCCATGTTGAATAAGTCGTACAGCTCAGTGGGAGTTAATAGAAGT ATATTAAATGGTAGCGTGACGGTCCCCATCATCGCTAATCATACACTGGAGATACTTGGG ACGCTGAAATTTGAATATATTATTATCACACCATTTGAACATCCACAACTGCCCTTAGAA AGAACAGAAACGTACTGGAAATCCTTAGTGTCCACTCGTGTTATAGGACATAGAGGCCTG GGTAAAAATAATCCTAATAAATCATTACAAATTGGAGAGAACACAGTCGAGTCTTTCATC ATGGCAGCCTCATTGGGAGCATCGTATGTAGAGTTTGATGTTCAGTTGACGAAGGATAAC GTACCAGTGGTATATCACGATTTTCTCGTAGCTGAAACAGGTGTCGATATCCCCATGCAT GAATTGACGCTGGAACAGTTTTTAGATTTGAACAATGCCGATAAAGAGCACATTCAACGT GGAGCAGGTCACTCACCTCATCATGTAAATGGAGCAGATACAGCACTACAAAAATATAGA GGGCGTTCGGTAGATGATTCAGACGTTAGTACATTGAGGAGAGCTTGGGATTTACACGAC AACGACCCGAATGGGAAGTCCAACAATGCTCATTGGTCTGACAATCGAATGAGGCTAACC AAAACATTTAAAAAGAACAATTTTAAGGGAAACGCTAGAGGACATTCAATAGCTTCATCA TTTGTTACCTTGAAAGAACTATTCAAGAAAATCCCTGCCAACGTTGGGTTTAACATAGAA TGTAAGTTTCCCATGCTTGATGAGGCAGAAGAGGAAGAGTTAGGGCAAATAATGATGGAA ATGAACCATTGGGTTGACACCGTGTTAAAAGTAGTTTTTGACAATGCGAATGGTAGGGAC ATCATTTTTTCGTCATTTCATCCGGATATTTGCATCATGCTTTCGTTAAAGCAACCGGTT ATTCCGATCTTGTTCCTGACGGAAGGTGGAAGTGAACAGATGGCCGATTTGAGAGCCTCA TCGTTACAAAACGGTATAAGATTTGCTAAGAAGTGGAATTTATTGGGGATTGTATCTGCT GCAGCACCCATTTTAAAGGCCCCACGGTTGGTGCAAGTGGTTAAGTCTAATGGGCTGGTA TGTGTCACTTACGGTGTGGACAACAATGATCCCGAAAATGCCAGTATACAAATTGAAGCA GGTGTAGATGCCGTGATCGTCGATAGTGTATTGGCAATTAGACGTGGGTTAACCAAAAAG AATGAAAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues1223
Protein Molecular Weight138013.0
Protein Theoretical pI6.77
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycerophosphodiester phosphodiesterase GDE1 MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEITRLQEDIYRAHNKNSYDEGRPPTKMRDS SNSAQNYLDSPKIQKLLASFFFAVDRDIEKVDTFYNSQYAEYKKRFERLLSSNQFNEIKS TLVVDANKEDAVAQTLLTKDTREMNMLLKGTSQASRLSYHKDDLIEIQSILAELRKQFRN LKWYAELNKRAFGKILKKLDKKVGTNQQMSTMKTRILPLQFANDSLITKDLSLLKTIWEQ VTFRINSYERVMRSTSPNANANDNTEFFKIICVFIEEDDSKGLIRELTNLYSELSLIPTR IMISVLNKAALSKSLACIDAILKVIPSLNDSEDINRRNFFHHHIIAIGKLIRKQEILSRK KKSQPSKYTNSEGEIVTDLRTLHTTLSAPAESDSITEEEKSSACTLSYILEELPIHLRPC LFQHDNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLC VLGAHPKTTEVLLQSLDPNVKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHE TPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFD IEDEGGWTPMEHAVLRGHLHIADMVQIRDELVTHPHSQLNSGSEEKEPLNEISAGELNER NENGNGGNKGSLGKLAGPIKSYGHRFLDNNESLILITLGSNDTRNKSPSISLSSEALAKV IGLETDCALSLVISCNDSIDKSSVILDLPLDDNVDAVDFKVPFKVDYSHTLYFDIVPTYG TRSLETHNRIDCQKNNNNYVMARGVSMLNKSYSSVGVNRSILNGSVTVPIIANHTLEILG TLKFEYIIITPFEHPQLPLERTETYWKSLVSTRVIGHRGLGKNNPNKSLQIGENTVESFI MAASLGASYVEFDVQLTKDNVPVVYHDFLVAETGVDIPMHELTLEQFLDLNNADKEHIQR GAGHSPHHVNGADTALQKYRGRSVDDSDVSTLRRAWDLHDNDPNGKSNNAHWSDNRMRLT KTFKKNNFKGNARGHSIASSFVTLKELFKKIPANVGFNIECKFPMLDEAEEEELGQIMME MNHWVDTVLKVVFDNANGRDIIFSSFHPDICIMLSLKQPVIPILFLTEGGSEQMADLRAS SLQNGIRFAKKWNLLGIVSAAAPILKAPRLVQVVKSNGLVCVTYGVDNNDPENASIQIEA GVDAVIVDSVLAIRRGLTKKNEK
References
External Links
ResourceLink
Saccharomyces Genome Database GDE1
Uniprot IDQ02979
Uniprot NameGDE1_YEAST
GenBank Gene IDU43503
Genebank Protein ID1163103
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Fisher, E., Almaguer, C., Holic, R., Griac, P., Patton-Vogt, J. (2005). "Glycerophosphocholine-dependent growth requires Gde1p (YPL110c) and Git1p in Saccharomyces cerevisiae." J Biol Chem 280:36110-36117.16141200
  • Fernandez-Murray, J. P., McMaster, C. R. (2005). "Glycerophosphocholine catabolism as a new route for choline formation for phosphatidylcholine synthesis by the Kennedy pathway." J Biol Chem 280:38290-38296.16172116
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956