Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameVacuolar protein sorting-associated protein 30
Synonyms
  • Autophagy-related protein 6
Gene NameVPS30
Enzyme ClassNot Available
Biological Properties
General Functionretrograde transport, endosome to Golgi
Specific FunctionRequired for cytoplasm to vacuole transport (Cvt), autophagy, nucleophagy, and mitophagy, as a part of the autophagy-specific VPS34 PI3-kinase complex I. This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure. Also involved in endosome-to-Golgi retrograde transport as part of the VPS34 PI3-kinase complex II. This second complex is required for the endosome-to-Golgi retrieval of PEP1 and KEX2, and the recruitment of VPS5 and VPS7, two components of the retromer complex, to endosomal membranes (probably through the synthesis of a specific pool of phosphatidylinositol 3-phosphate recruiting the retromer to the endosomes). Plays also a role in regulation of filamentous growth.
Cellular LocationNot Available
SMPDB Pathways
Inositol MetabolismPW002498 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
1-Phosphatidyl-D-myo-inositol + Adenosine triphosphate1-Phosphatidyl-1D-myo-inositol 3-phosphate + ADP
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00914ADPShow
YMDB161651-Phosphatidyl-1D-myo-inositol 3-phosphateShow
GO Classification
Function
phosphatidylinositol 3-kinase complex, class III, type II
late endosome to vacuole transport
macroautophagy
pexophagy
protein targeting to vacuole
extrinsic component of membrane
cytoplasmic, membrane-bounded vesicle
pre-autophagosomal structure
pre-autophagosomal structure membrane
autophagosome assembly
autophagy
cellular response to nitrogen starvation
cytosol
CVT pathway
cytoplasm
phosphatidylinositol biosynthetic process
endosome membrane
piecemeal microautophagy of nucleus
phosphatidylinositol 3-kinase complex, class III, type I
retrograde transport, endosome to Golgi
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1674 bp ATGAAGTGCCAAACATGTCACTTACCCCTGCAACTAGACCCATCTTTAGAAGGTCTTAGT TTAACCCAAAGAAATTTGCTACTTTCAAATAATTCAATTATCACTGCAACGAATGAAAAT GTCATCAGCAACAAGGGCATCGAAGCCGCAGATAATTGTGGGCCTCAAATACCGAAGGAG AGGCTGAGGCGATTAGGGGAGATTCAGAACATAAAAGACTTGAATTTAAAAGATGATAAA TTAATCACTGATTCGTTTGTTTTTCTTAATCACGATGATGATGATAATGCTAATATTACG AGTAATAGCAGAGAGGACCAGCGTTATGGAAATGCCAACGGAAATGATAATAAAAAAGCT AATAGTGATACTTCCGATGGAACCAGTACCTTTCGAGATCATGACGAAGAGGAACAAGAA GCTACGGATGAGGACGAAAACCAACAAATACAATTGAATTCCAAGACTTTGTCCACACAA GTCAACGCAATGACTAATGTATTTAACATTCTATCTTCTCAAACAAACATAGACTTTCCT ATCTGTCAGGACTGCTGTAACATCTTGATAAACAGACTAAAAAGTGAGTATGATGATGCA ATAAAAGAGAGAGATACTTACGCTCAATTTTTATCGAAGTTAGAGAGTCAAAACAAAGAA ATATCAGAAAGCAATAAAGAAAAGCAGTATTCCCATAATCTTTCGGAAAAAGAAAATTTG AAAAAGGAAGAGGAAAGACTCTTGGATCAATTATTACGTTTGGAAATGACAGATGATGAC TTAGATGGAGAACTAGTTCGTTTACAAGAAAAGAAAGTTCAACTGGAAAATGAGAAACTC CAAAAACTGAGTGATCAGAATTTAATGGATTTAAATAACATTCAATTCAACAAAAATTTA CAGTCATTAAAACTGCAATACGAATTATCCTTGAATCAATTAGATAAGTTGAGGAAAATC AATATTTTCAATGCTACATTCAAAATCTCACATAGCGGCCCCTTTGCCACTATAAATGGA TTGAGATTAGGCAGTATACCAGAATCAGTGGTACCTTGGAAGGAAATCAATGCAGCACTG GGCCAATTGATTCTTTTACTGGCTACCATAAACAAAAACCTGAAGATAAATTTAGTAGAC TACGAATTACAACCGATGGGTTCATTTTCCAAAATCAAGAAAAGAATGGTTAACAGTGTC GAATATAATAATTCCACTACGAACGCTCCCGGTGATTGGTTGATTCTGCCTGTCTACTAT GATGAGAATTTCAATTTGGGGAGAATCTTCCGCAAGGAAACGAAGTTTGATAAATCATTA GAAACAACATTAGAAATAATAAGCGAAATCACTCGGCAGCTTTCTACGATAGCGTCATCA TATTCATCTCAAACACTCACAACAAGCCAAGATGAATCTTCAATGAATAACGCAAATGAC GTTGAAAATAGTACTTCCATTCTCGAGCTACCCTATATCATGAATAAGGACAAGATTAAT GGATTATCCGTCAAATTGCATGGTAGCAGTCCCAACCTTGAATGGACAACGGCTATGAAA TTTTTATTAACCAATGTAAAGTGGTTGTTAGCGTTTTCTTCCAATTTACTATCCAAGTCA ATTACCTTAAGCCCTACAGTGAATTACAATGATAAGACCATCAGCGGAAACTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues557
Protein Molecular Weight63260.22
Protein Theoretical pINot Available
PDB Fileshow
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Vacuolar protein sorting-associated protein 30 MKCQTCHLPLQLDPSLEGLSLTQRNLLLSNNSIITATNENVISNKGIEAADNCGPQIPKE RLRRLGEIQNIKDLNLKDDKLITDSFVFLNHDDDDNANITSNSREDQRYGNANGNDNKKA NSDTSDGTSTFRDHDEEEQEATDEDENQQIQLNSKTLSTQVNAMTNVFNILSSQTNIDFP ICQDCCNILINRLKSEYDDAIKERDTYAQFLSKLESQNKEISESNKEKQYSHNLSEKENL KKEEERLLDQLLRLEMTDDDLDGELVRLQEKKVQLENEKLQKLSDQNLMDLNNIQFNKNL QSLKLQYELSLNQLDKLRKINIFNATFKISHSGPFATINGLRLGSIPESVVPWKEINAAL GQLILLLATINKNLKINLVDYELQPMGSFSKIKKRMVNSVEYNNSTTNAPGDWLILPVYY DENFNLGRIFRKETKFDKSLETTLEIISEITRQLSTIASSYSSQTLTTSQDESSMNNAND VENSTSILELPYIMNKDKINGLSVKLHGSSPNLEWTTAMKFLLTNVKWLLAFSSNLLSKS ITLSPTVNYNDKTISGN
References
External Links
ResourceLink
Saccharomyces Genome Database VPS30
Uniprot IDQ02948
Uniprot NameVPS30
PDB ID
3VP7
General ReferenceNot Available