You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlkaline ceramidase YDC1
SynonymsNot Available
Gene NameYDC1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Specific FunctionCatalyzes the conversion of dihydroceramide and also phytoceramide to dihydrosphingosine or phytosphingosine. Prefers dihydroceramide. Very low reverse hydrolysis activity, catalyzing synthesis of dihydroceramide from fatty acid and dihydrosphingosine. Is not responsible for the breakdown of unsaturated ceramide. May play a role in heat stress response
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Sphinganine + Tetracosanoyl-CoA N-tetracosanoylsphinganine + hydron + Coenzyme A
Sphinganine + hexacosanoyl-CoAN-hexacosanylsphinganine + hydron + Coenzyme A
Phytosphingosine + Tetracosanoyl-CoA N-Tetracosanoylphytosphingosine + hydron + Coenzyme A
Phytosphingosine + hexacosanoyl-CoAN-Hexacosanoylphytosphingosine + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00285PhytosphingosineShow
YMDB00327SphinganineShow
YMDB00537hexacosanoyl-CoAShow
YMDB00619N-tetracosanoylsphinganineShow
YMDB00621N-hexacosanylsphinganineShow
YMDB00862hydronShow
YMDB00909Tetracosanoyl-CoA Show
YMDB00963N-TetracosanoylphytosphingosineShow
YMDB00964N-HexacosanoylphytosphingosineShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
catalytic activity
Process
primary metabolic process
lipid metabolic process
cellular lipid metabolic process
metabolic process
membrane lipid metabolic process
sphingolipid metabolic process
sphingoid metabolic process
ceramide metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL087W
Gene Sequence>954 bp ATGCTGTTCAGCTGGCCTTATCCAGAAGCCCCGATTGAAGGTTATTGGGGCAAGCCAACT TCTCTGATTGATTGGTGCGAGGAGAATTATGTCGTATCCCCCTATATTGCAGAATGGTCA AATACTATTACCAATAGTATATTCTTAATGACCGCCTTCTATTCTACATATAGCGCTTGG CGTAATAAGTTAGAAACAAGGTATATATTGATAGGAATGGGGTTCTCGCTGGTTGGTATT GGTTCGTGGTTATTTCATATGACTTTACAGTATCGTTATCAATTGCTAGACGAACTACCA ATGCTGTATGCGACCATCATCCCATCGTGGAGTATTTTTGCAGAAACTCAAGAAATCTTG ATTAAGGATGAGAAGAAAAGGAAGGAAAGCTCATTTAGAATCCAAATGGTCATTTCTTTT ATCATGTGTGGTATAGTCACCATTTTAACCTGGATTTACGTTGTCGTCCAAAAGCCAGCA ATTTTCCAAGTCCTTTATGGTATATTGACGCTTCTAGTTGTGGTTCTTTCTGGCTGGCTG ACCTACTATCACGTTCATGATTCATTTGCAAAGAAAAATCTTTTTATTACTATGGTTATG GGCATGATTCCTTTTGTCATTGGGTTCATTTGCTGGCAACTAGATATTCACCTGTGTTCT TTTTGGATCTATATCCGGAGAACATATTTGGCCCTGCCATTAGGTGTTCTATTGGAACTG CATGCTTGGTGGCATCTTTTGACCGGTACTGGTGTCTATATCTTCGTCGTGTATTTGCAA TATTTGAGAATATTAACCCATGGAAATCCAAATGACTTCTTATTTATATGGAGGTGGGGA TTTTTCCCTGAGCTGGTAAGAAAGGGCTTACCGATTGGTACTTCTTATTCACTGGAGTAT CTGGGGCCAATTGTAAATACACAGGTAGATGATGAAACAAAAAAGAATAACTAA
Protein Properties
Pfam Domain Function
Protein Residues317
Protein Molecular Weight37230.5
Protein Theoretical pI7.17
Signalling Regions
  • None
Transmembrane Regions
  • 43-60
  • 67-89
  • 99-121
  • 134-156
  • 160-182
  • 203-225
  • 240-262
Protein Sequence>Alkaline ceramidase YDC1 MLFSWPYPEAPIEGYWGKPTSLIDWCEENYVVSPYIAEWSNTITNSIFLMTAFYSTYSAW RNKLETRYILIGMGFSLVGIGSWLFHMTLQYRYQLLDELPMLYATIIPSWSIFAETQEIL IKDEKKRKESSFRIQMVISFIMCGIVTILTWIYVVVQKPAIFQVLYGILTLLVVVLSGWL TYYHVHDSFAKKNLFITMVMGMIPFVIGFICWQLDIHLCSFWIYIRRTYLALPLGVLLEL HAWWHLLTGTGVYIFVVYLQYLRILTHGNPNDFLFIWRWGFFPELVRKGLPIGTSYSLEY LGPIVNTQVDDETKKNN
References
External Links
ResourceLink
Saccharomyces Genome Database YDC1
Uniprot IDQ02896
Uniprot NameYDC1_YEAST
GenBank Gene IDAF214455
Genebank Protein ID10764171
General Reference
  • Mao, C., Xu, R., Bielawska, A., Szulc, Z. M., Obeid, L. M. (2000). "Cloning and characterization of a Saccharomyces cerevisiae alkaline ceramidase with specificity for dihydroceramide." J Biol Chem 275:31369-31378.10900202
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258