You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMonothiol glutaredoxin-5, mitochondrial
SynonymsNot Available
Gene NameGRX5
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in electron carrier activity
Specific FunctionMonothiol glutaredoxin involved in iron-sulfur biogenesis. Required for normal iron homeostasis. Protects cells against oxidative damage due to reactive oxygen species
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Hydrogen peroxide + Glutathionewater + Oxidized glutathione
Metabolites
YMDB IDNameView
YMDB00057Oxidized glutathioneShow
YMDB00160GlutathioneShow
YMDB00693glutathione disulfideShow
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on a sulfur group of donors
disulfide oxidoreductase activity
protein disulfide oxidoreductase activity
catalytic activity
oxidoreductase activity
electron carrier activity
Process
cellular process
cellular homeostasis
cell redox homeostasis
Gene Properties
Chromosome Locationchromosome 16
LocusYPL059W
Gene Sequence>453 bp ATGTTTCTCCCAAAATTCAATCCCATAAGGTCATTTTCCCCCATCCTCCGGGCTAAGACT CTTCTTCGTTACCAAAATCGGATGTATTTGAGCACAGAGATAAGAAAAGCTATTGAAGAT GCCATCGAATCGGCTCCAGTGGTTCTTTTCATGAAAGGTACTCCTGAATTTCCCAAGTGT GGATTTTCAAGAGCAACCATTGGATTATTAGGAAATCAAGGCGTTGACCCGGCCAAATTT GCGGCTTATAATGTTTTAGAAGACCCAGAGCTACGTGAAGGTATCAAAGAGTTTTCAGAA TGGCCAACTATTCCACAGTTATATGTAAACAAAGAATTCATTGGTGGATGTGATGTTATT ACAAGTATGGCACGCTCTGGTGAATTGGCCGATTTGCTAGAAGAGGCACAGGCATTGGTA CCTGAAGAAGAAGAAGAAACCAAAGATCGTTGA
Protein Properties
Pfam Domain Function
Protein Residues150
Protein Molecular Weight16931.30078
Protein Theoretical pI4.54
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Monothiol glutaredoxin-5, mitochondrial MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRKAIEDAIESAPVVLFMKGTPEFPKC GFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVI TSMARSGELADLLEEAQALVPEEEEETKDR
References
External Links
ResourceLink
Saccharomyces Genome Database GRX5
Uniprot IDQ02784
Uniprot NameGLRX5_YEAST
GenBank Gene IDU39205
Genebank Protein ID1079683
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Rodriguez-Manzaneque, M. T., Tamarit, J., Belli, G., Ros, J., Herrero, E. (2002). "Grx5 is a mitochondrial glutaredoxin required for the activity of iron/sulfur enzymes." Mol Biol Cell 13:1109-1121.11950925
  • Tamarit, J., Belli, G., Cabiscol, E., Herrero, E., Ros, J. (2003). "Biochemical characterization of yeast mitochondrial Grx5 monothiol glutaredoxin." J Biol Chem 278:25745-25751.12730244
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106