You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethylenetetrahydrofolate dehydrogenase [NAD+]
SynonymsNot Available
Gene NameMTD1
Enzyme Class
Biological Properties
General FunctionInvolved in binding
Specific FunctionCatalyzes oxidation of cytoplasmic one-carbon units for purine biosynthesis
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
One carbon pool by folateec00670 Map00670
SMPDB ReactionsNot Available
KEGG Reactions
NAD + 5,10-Methylene-THFNADH + (6R)-5,10-Methenyltetrahydrofolic acid
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB001765,10-Methenyltetrahydrofolic acidShow
YMDB002605,10-Methylene-THFShow
YMDB00412NAD(+)Show
YMDB00515(6R)-5,10-Methenyltetrahydrofolic acidShow
YMDB00848(6R)-5,10-methylenetetrahydrofolic acidShow
YMDB008795,10-MethenyltetrahydrofolateShow
GO Classification
Component
Not Available
Function
binding
catalytic activity
Process
metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
folic acid and derivative metabolic process
folic acid and derivative biosynthetic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKR080W
Gene Sequence>963 bp ATGTCGAAGCCTGGTCGTACTATTTTAGCAAGCAAGGTCGCCGAAACTTTCAATACCGAA ATAATTAACAACGTAGAGGAATACAAGAAGACACATAATGGTCAAGGTCCCCTTCTTGTG GGATTCCTAGCTAATAATGATCCTGCTGCAAAGATGTATGCTACATGGACTCAAAAGACT AGCGAGTCAATGGGGTTCCGCTATGACTTAAGGGTCATTGAAGATAAGGATTTTTTGGAA GAAGCGATAATACAAGCTAACGGCGATGACTCTGTGAACGGTATCATGGTATACTTTCCT GTTTTCGGTAATGCTCAAGATCAGTATTTGCAACAGGTTGTGTGCAAGGAAAAGGATGTA GAAGGGTTAAATCATGTTTACTACCAAAACCTGTACCATAATGTCAGATACCTGGACAAA GAAAACCGTTTGAAATCCATTCTACCTTGCACACCACTAGCTATCGTTAAGATATTGGAA TTCTTGAAAATTTACAACAATTTGTTACCAGAAGGAAACAGACTGTATGGGAAGAAATGC ATAGTAATTAACAGGTCAGAAATCGTCGGTAGACCACTGGCGGCGCTATTAGCCAATGAT GGTGCCACAGTATACTCTGTGGACGTTAACAACATTCAAAAATTCACCCGTGGTGAAAGT TTGAAATTAAACAAGCATCATGTGGAAGACCTTGGGGAGTACTCTGAAGATCTGTTGAAA AAGTGTTCTCTTGATTCAGATGTGGTCATCACTGGTGTCCCTAGTGAAAATTACAAATTC CCCACCGAATACATCAAAGAAGGTGCCGTCTGCATCAATTTTGCATGCACCAAAAATTTT AGCGATGATGTCAAGGAAAAAGCTTCTCTTTACGTTCCAATGACTGGTAAAGTTACCATT GCAATGTTGTTGAGAAACATGTTACGTTTAGTAAGGAACGTAGAACTGTCTAAAGAAAAA TAG
Protein Properties
Pfam Domain Function
Protein Residues320
Protein Molecular Weight36239.30078
Protein Theoretical pI7.01
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methylenetetrahydrofolate dehydrogenase [NAD+] MSKPGRTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKT SESMGFRYDLRVIEDKDFLEEAIIQANGDDSVNGIMVYFPVFGNAQDQYLQQVVCKEKDV EGLNHVYYQNLYHNVRYLDKENRLKSILPCTPLAIVKILEFLKIYNNLLPEGNRLYGKKC IVINRSEIVGRPLAALLANDGATVYSVDVNNIQKFTRGESLKLNKHHVEDLGEYSEDLLK KCSLDSDVVITGVPSENYKFPTEYIKEGAVCINFACTKNFSDDVKEKASLYVPMTGKVTI AMLLRNMLRLVRNVELSKEK
References
External Links
ResourceLink
Saccharomyces Genome Database MTD1
Uniprot IDQ02046
Uniprot NameMTD1_YEAST
GenBank Gene IDL02934
Genebank Protein ID172016
PDB ID
1EE9
General Reference
  • West, M. G., Barlowe, C. K., Appling, D. R. (1993). "Cloning and characterization of the Saccharomyces cerevisiae gene encoding NAD-dependent 5,10-methylenetetrahydrofolate dehydrogenase." J Biol Chem 268:153-160.8416923
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Garcia-Cantalejo, J., Baladron, V., Esteban, P. F., Santos, M. A., Bou, G., Remacha, M. A., Revuelta, J. L., Ballesta, J. P., Jimenez, A., del Rey, F. (1994). "The complete sequence of an 18,002 bp segment of Saccharomyces cerevisiae chromosome XI contains the HBS1, MRP-L20 and PRP16 genes, and six new open reading frames." Yeast 10:231-245.8203164
  • Barlowe, C. K., Appling, D. R. (1990). "Isolation and characterization of a novel eukaryotic monofunctional NAD(+)-dependent 5,10-methylenetetrahydrofolate dehydrogenase." Biochemistry 29:7089-7094.2223762
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Monzingo, A. F., Breksa, A., Ernst, S., Appling, D. R., Robertus, J. D. (2000). "The X-ray structure of the NAD-dependent 5,10-methylenetetrahydrofolate dehydrogenase from Saccharomyces cerevisiae." Protein Sci 9:1374-1381.10933503