You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameADP-ribose pyrophosphatase
Synonyms
  • ADP-ribose diphosphatase
  • ADP-ribose phosphohydrolase
  • Adenosine diphosphoribose pyrophosphatase
  • ADPR-PPase
Gene NameYSA1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionADP-ribose + H(2)O = AMP + D-ribose 5- phosphate
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00119D-Ribose 5-phosphateShow
YMDB00360Adenosine diphosphate riboseShow
YMDB00890waterShow
YMDB00967ADP-D-riboseShow
GO Classification
Component
Not Available
Function
hydrolase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 2
LocusYBR111C
Gene Sequence>696 bp ATGTTTTTGAGAAACGTAAGAGTTATTTCCCTCAATTCAAGGAGACTATTTAGAACTATG AGCACCGTCAAGGGTAAACCAGAAGATGCTAAAATAATTGAAGCCCGTCACGTTAAAGAA ACATCTGACTGCAAGTGGATCGGTTTACAAAAAATCATCTACAAAGATCCCAACGGGAAG GAAAGGGAATGGGATAGCGCAGTCCGCACCACTAGAAGTTCCGGTGGTGTAGACGGCATT GGTATCTTAACCATTCTAAAATACAAAGATGGAAAACCTGATGAAATTTTGCTACAAAAG CAGTTTCGCCCTCCCGTTGAGGGCGTATGCATTGAGATGCCAGCCGGTTTGATAGATGCG GGTGAAGATATTGACACTGCTGCCTTAAGAGAATTAAAAGAAGAGACTGGTTACAGTGGT AAAATAATTTCTAAAAGCCCAACAGTTTTTAACGATCCTGGTTTCACAAACACCAACCTC TGTCTGGTTACTGTCGAAGTTGATATGAGTTTACCTGAAAACCAAAAACCAGTTACTCAA TTGGAAGATAATGAATTTATCGAATGCTTTAGCGTTGAGTTGCACAAGTTTCCTGATGAA ATGGTTAAGTTGGATCAACAAGGCTACAAGTTGGATGCACGTGTTCAAAACGTAGCTCAA GGTATCCTCATGGCCAAGCAATACCACATCAAATAG
Protein Properties
Pfam Domain Function
Protein Residues231
Protein Molecular Weight26086.80078
Protein Theoretical pI6.3
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>ADP-ribose pyrophosphatase MFLRNVRVISLNSRRLFRTMSTVKGKPEDAKIIEARHVKETSDCKWIGLQKIIYKDPNGK EREWDSAVRTTRSSGGVDGIGILTILKYKDGKPDEILLQKQFRPPVEGVCIEMPAGLIDA GEDIDTAALRELKEETGYSGKIISKSPTVFNDPGFTNTNLCLVTVEVDMSLPENQKPVTQ LEDNEFIECFSVELHKFPDEMVKLDQQGYKLDARVQNVAQGILMAKQYHIK
References
External Links
ResourceLink
Saccharomyces Genome Database YSA1
Uniprot IDQ01976
Uniprot NameADPP_YEAST
GenBank Gene IDAY558185
Genebank Protein ID45270260
General Reference
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1994). "Analysis of a 70 kb region on the right arm of yeast chromosome II." Yeast 10:1363-1381.7900426
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1992). "Molecular analysis of yeast chromosome II between CMD1 and LYS2: the excision repair gene RAD16 located in this region belongs to a novel group of double-finger proteins." Yeast 8:397-408.1626431
  • Dunn, C. A., O'Handley, S. F., Frick, D. N., Bessman, M. J. (1999). "Studies on the ADP-ribose pyrophosphatase subfamily of the nudix hydrolases and tentative identification of trgB, a gene associated with tellurite resistance." J Biol Chem 274:32318-32324.10542272
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956