You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAspartate aminotransferase, mitochondrial
Synonyms
  • Transaminase A
Gene NameAAT1
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring nitrogenous groups
Specific FunctionPlays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol
Cellular LocationMitochondrion matrix
SMPDB Pathways
Asparagine metabolismPW002274 ThumbThumb?image type=greyscaleThumb?image type=simple
Aspartate metabolismPW002375 ThumbThumb?image type=greyscaleThumb?image type=simple
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
Cysteine and methionine metabolismec00270 Map00270
Phenylalanine metabolismec00360 Map00360
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
SMPDB Reactions
L-Glutamic acid + Oxalacetic acidL-Aspartic acid + Oxoglutaric acid
L-Aspartic acid + Oxoglutaric acidOxalacetic acid + L-Glutamic acid
KEGG Reactions
L-Aspartic acid + Oxoglutaric acidL-Glutamic acid + Oxalacetic acid
Oxoglutaric acid + erythro-4-hydroxy-L-glutamic acid4-hydroxy-2-oxoglutaric acid + L-Glutamic acid
L-Glutamic acid + (4-hydroxyphenyl)pyruvic acidL-Tyrosine + Oxoglutaric acid
Metabolites
YMDB IDNameView
YMDB00153Oxoglutaric acidShow
YMDB00235Oxalacetic acidShow
YMDB00271L-Glutamic acidShow
YMDB00364L-TyrosineShow
YMDB00719erythro-4-hydroxy-L-glutamic acidShow
YMDB007224-hydroxy-2-oxoglutaric acidShow
YMDB00896L-Aspartic acidShow
YMDB00958(4-hydroxyphenyl)pyruvic acidShow
GO Classification
Component
Not Available
Function
binding
transferase activity, transferring nitrogenous groups
transaminase activity
catalytic activity
cofactor binding
transferase activity
pyridoxal phosphate binding
Process
biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL106W
Gene Sequence>1356 bp ATGTTGAGGACGAGGCTTACTAATTGCAGTCTATGGAGGCCCTACTACACGTCATCGCTT AGTAGAGTACCAAGAGCACCTCCAGATAAAGTCTTGGGGTTATCTGAACACTTCAAAAAG GCAAAAAATGTTAACAAAATTGACCTGACCGTAGGAATATATAAAGATGGTTGGGGCAAA GTGACGACGTTTCCCTCCGTTGCAAAAGCTCAAAAATTGATTGAATCTCATTTAGAGTTG AATAAGAATCTTTCATATTTACCAATAACAGGTTCCAAAGAATTTCAGGAAAACGTTATG AAATTTTTGTTCAAGGAATCATGTCCGCAGTTTGGGCCATTTTATTTAGCCCATGATAGA ATCAGCTTTGTTCAGACTTTGAGTGGTACAGGCGCCCTAGCTGTAGCAGCTAAATTCTTG GCATTATTTATTTCAAGAGATATTTGGATACCTGACCCATCATGGGCAAATCATAAGAAC ATTTTTCAGAACAATGGTTTTGAAAATATTTACCGGTATTCCTATTATAAGGACGGTCAG ATAGACATCGACGGATGGATTGAGCAATTGAAAACCTTTGCATATAACAACCAGCAAGAA AACAATAAGAACCCACCTTGCATAATCTTGCATGCGTGTTGTCACAACCCTACAGGTCTC GACCCAACTAAAGAGCAATGGGAAAAGATTATAGATACTATATATGAGCTAAAAATGGTA CCCATTGTTGATATGGCTTATCAGGGTTTAGAGTCTGGTAACTTACTAAAGGACGCATAT TTATTGAGGCTATGTCTCAATGTAAATAAATATCCAAATTGGAGTAACGGTATCTTTCTT TGTCAATCTTTTGCCAAGAACATGGGCCTTTATGGTGAACGAGTTGGTTCCTTAAGCGTT ATCACGCCGGCAACTGCGAACAATGGAAAGTTCAACCCTCTACAACAGAAAAACTCATTG CAGCAAAATATTGACTCCCAATTAAAAAAGATTGTCAGAGGTATGTATTCTTCTCCACCA GGATACGGTTCTCGTGTGGTAAATGTAGTATTATCAGATTTCAAATTGAAACAGCAATGG TTCAAGGATGTTGATTTCATGGTTCAGAGATTGCATCACGTCAGACAGGAGATGTTTGAC CGTCTAGGGTGGCCGGATCTTGTAAATTTCGCACAACAGCACGGTATGTTTTACTATACA AGGTTTAGTCCAAAGCAAGTCGAAATATTGAGAAACAATTCATTCGTCTATTTAACAGGT GATGGTAGATTGTCGCTTAGCGGAGTCAATGATTCGAACGTTGATTACTTATGTGAATCT CTTGAAGCAGTCTCGAAAATGGACAAACTCGCATAA
Protein Properties
Pfam Domain Function
Protein Residues451
Protein Molecular Weight51795.10156
Protein Theoretical pI9.22
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aspartate aminotransferase, mitochondrial MLRTRLTNCSLWRPYYTSSLSRVPRAPPDKVLGLSEHFKKVKNVNKIDLTVGIYKDGWGK VTTFPSVAKAQKLIESHLELNKNLSYLPITGSKEFQENVMKFLFKESCPQFGPFYLAHDR ISFVQTLSGTGALAVAAKFLALFISRDIWIPDPSWANHKNIFQNNGFENIYRYSYYKDGQ IDIDGWIEQLKTFAYNNQQENNKNPPCIILHACCHNPTGLDPTKEQWEKIIDTIYELKMV PIVDMAYQGLESGNLLKDAYLLRLCLNVNKYPNWSNGIFLCQSFAKNMGLYGERVGSLSV ITPATANNGKFNPLQQKNSLQQNIDSQLKKIVRGMYSSPPGYGSRVVNVVLSDFKLKQQW FKDVDFMVQRLHHVRQEMFDRLGWPDLVNFAQQHGMFYYTRFSPKQVEILRNNYFVYLTG DGRLSLSGVNDSNVDYLCESLEAVSKMDKLA
References
External Links
ResourceLink
Saccharomyces Genome Database AAT1
Uniprot IDQ01802
Uniprot NameAATM_YEAST
GenBank Gene IDX68052
Genebank Protein ID3318
General Reference
  • Morin, P. J., Subramanian, G. S., Gilmore, T. D. (1992). "AAT1, a gene encoding a mitochondrial aspartate aminotransferase in Saccharomyces cerevisiae." Biochim Biophys Acta 1171:211-214.1482685
  • Cheret, G., Pallier, C., Valens, M., Diagnan-Fornier, B., Fukuhara, H., Bolotin-Fukuhara, M., Sor, F. (1993). "The DNA sequence analysis of the HAP4-LAP4 region on chromosome XI of Saccharomyces cerevisiae suggests the presence of a second aspartate aminotransferase gene in yeast." Yeast 9:1259-1265.8109175
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961