You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenylosuccinate synthetase
Synonyms
  • AMPSase
  • AS-synthetase
  • AdSS
  • IMP--aspartate ligase
Gene NameADE12
Enzyme Class
Biological Properties
General FunctionInvolved in adenylosuccinate synthase activity
Specific FunctionPlays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first commited step in the biosynthesis of AMP from IMP
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
GTP + Inosinic acid + L-Aspartic acidphosphate + hydron + Guanosine diphosphate + Adenylsuccinic acid
Metabolites
YMDB IDNameView
YMDB00012Adenylsuccinic acidShow
YMDB00257Guanosine diphosphateShow
YMDB00352Inosinic acidShow
YMDB00558GTPShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
YMDB00907phosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
binding
GTP binding
ligase activity
adenylosuccinate synthase activity
ligase activity, forming carbon-nitrogen bonds
nucleotide binding
ion binding
cation binding
metal ion binding
magnesium ion binding
purine nucleotide binding
catalytic activity
guanyl nucleotide binding
guanyl ribonucleotide binding
Process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
metabolic process
purine nucleotide biosynthetic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL220W
Gene Sequence>1302 bp ATGGTTAACGTTGTATTGGGCTCCCAATGGGGTGATGAGGGTAAAGGTAAACTAGTTGAT TTACTGGTTGGTAAATATGATATTGTAGCCCGTTGCGCCGGTGGTAACAATGCCGGGCAT ACCATTGTTGTAGACGGTGTTAAGTATGATTTCCATATGTTACCATCTGGTTTAGTCAAC CCAAACTGCCAAAACCTTTTGGGTAATGGTGTTGTTATTCATGTTCCATCTTTTTTCAAA GAGTTGGAAACCTTGGAAGCTAAAGGTTTGAAGAACGCAAGGAGTAGATTATTTGTTTCT TCCAGAGCACATTTAGTCTTTGACTTTCATCAGGTGACTGACAAGCTAAGAGAATTGGAG TTATCAGGTCGTTCTAAAGATGGTAAAAATATCGGTACTACCGGTAAAGGTATTGGTCCA ACTTATTCCACAAAGGCTTCTAGATCTGGTTTGAGAGTTCATCATTTGGTGAATGATCAA CCCGGTGCCTGGGAGGAATTTGTTGCTAGATATAAGAGATTATTGGAAACGAGAAGACAA AGATACGGTGATTTCGAATACGACTTTGAAGCCAAGCTTGCTGAATACAAGAAGTTAAGA GAGCAACTAAAGCCATTCGTCGTCGATTCTGTCGTTTTCATGCACAATGCTATTGAAGCA AAGAAAAAGATATTGGTTGAGGGTGCTAATGCTTTGATGTTGGATATTGATTTTGGTACT TATCCATATGTGACTTCTTCCAATACTGGTATTGGTGGTGTCCTCACCGGTTTAGGTATT CCTCCACGTACTATTGATGAAATTTATGGTGTTGTTAAAGCCTACACAACTAGAGTTGGT GAAGGTCCTTTCCCAACGGAACAATTGAACGAAAATGGAGAAAAACTGCAGACCATTGGT GCTGAATTTGGTGTCACTACTGGTCGTAAGCGTCGTTGCGGTTGGTTAGACTTGGTAGTC TTGAAATACTCAACTTTGATCAATGGATACACGAGTTTGAACATTACCAAGTTAGACGTC CTCGATACTTTCAAAGAAATCCCAGTGGGTATTTCATATTCTATTCAAGGTAAGAAGCTA GATTTGTTCCCTGAAGACTTGAATATTCTTGGTAAAGTTGAAGTTGAATACAAAGTTTTG CCAGGTTGGGATCAAGATATTACCAAAATTACAAAGTATGAAGATTTGCCGGAAAACGCA AAGAAGTACTTAAAATATATTGAAGATTTTGTTGGCGTTCCTGTTGAATGGGTTGGTACC GGCCCCGCAAGAGAAAGCATGTTGCATAAAGAAATTAAATAG
Protein Properties
Pfam Domain Function
Protein Residues433
Protein Molecular Weight48279.10156
Protein Theoretical pI8.37
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenylosuccinate synthetase MVNVVLGSQWGDEGKGKLVDLLVGKYDIVARCAGGNNAGHTIVVDGVKYDFHMLPSGLVN PNCQNLLGNGVVIHVPSFFKELETLEAKGLKNARSRLFVSSRAHLVFDFHQVTDKLRELE LSGRSKDGKNIGTTGKGIGPTYSTKASRSGLRVHHLVNDQPGAWEEFVARYKRLLETRRQ RYGDFEYDFEAKLAEYKKLREQLKPFVVDSVVFMHNAIEAKKKILVEGANALMLDIDFGT YPYVTSSNTGIGGVLTGLGIPPRTIDEIYGVVKAYTTRVGEGPFPTEQLNENGEKLQTIG AEFGVTTGRKRRCGWLDLVVLKYSTLINGYTSLNITKLDVLDTFKEIPVGISYSIQGKKL DLFPEDLNILGKVEVEYKVLPGWDQDITKITKYEDLPENAKKYLKYIEDFVGVPVEWVGT GPARESMLHKEIK
References
External Links
ResourceLink
Saccharomyces Genome Database ADE12
Uniprot IDP80210
Uniprot NamePURA_YEAST
GenBank Gene IDL22185
Genebank Protein ID347863
General Reference
  • Andreichuk, I. u. V., Shabes, A. V., Ryzhova, T. A., Kotova, I. A., Domkin, V. D. (1995). "[Saccharomyces cerevisiae ADE12 gene, coding for adenylosuccinate synthetase (EC 6.3.4.4). Cloning, sequencing, expression, and superproduction]." Mol Gen Mikrobiol Virusol :21-28.7603488
  • Gallert, K. C., Ohanjan, T., Daignan-Fornier, B., Lottspeich, F., Krauss, G. (1996). "Enzymatic properties and inhibition by single-stranded autonomously replicating sequences of adenylosuccinate synthase from Saccharomyces cerevisiae." Eur J Biochem 239:487-493.8706758
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Zeidler, R., Hobert, O., Johannes, L., Faulhammer, H., Krauss, G. (1993). "Characterization of two novel single-stranded DNA-specific autonomously replicating sequence-binding proteins from Saccharomyces cerevisiae, one of which is adenylosuccinate synthetase." J Biol Chem 268:20191-20197.8376380
  • Lipps, G., Krauss, G. (1999). "Adenylosuccinate synthase from Saccharomyces cerevisiae: homologous overexpression, purification and characterization of the recombinant protein." Biochem J 341 ( Pt 3):537-543.10417315
  • Ryzhova, T. A., Andreichuk, Y. V., Domkin, V. D. (1998). "Adenylosuccinate synthetase of the yeast Saccharomyces cerevisiae: purification and properties." Biochemistry (Mosc) 63:650-656.9668204
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956