You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDynamin-related protein DNM1
SynonymsNot Available
Gene NameDNM1
Enzyme Class
Biological Properties
General FunctionInvolved in GTP binding
Specific FunctionMicrotubule-associated force-producing protein that participates mitochondrial fission. Fission of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. Functions antagonistically with FZO1
Cellular LocationMitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00558GTPShow
GO Classification
Component
Not Available
Function
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
nucleoside-triphosphatase activity
GTPase activity
catalytic activity
binding
nucleotide binding
hydrolase activity
purine nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
GTP binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLL001W
Gene Sequence>2274 bp ATGGCTAGTTTAGAAGATCTTATTCCTACTGTCAACAAGCTGCAGGATGTTATGTACGAC TCCGGGATCGATACACTCGATTTGCCCATTTTAGCTGTTGTTGGGTCACAATCCTCCGGG AAATCCTCGATATTGGAAACGTTAGTTGGAAGAGATTTTTTACCTAGGGGTACTGGTATT GTCACAAGAAGACCGTTAGTTCTTCAACTTAATAACATATCTCCAAATTCTCCTCTAATA GAGGAAGATGATAACTCAGTTAATCCACATGATGAAGTTACAAAAATATCAGGATTCGAA GCTGGTACGAAGCCCTTGGAGTATAGGGGCAAGGAAAGAAATCATGCAGATGAGTGGGGG GAATTCCTGCATATACCAGGAAAACGGTTTTATGATTTCGACGATATCAAAAGAGAAATC GAAAACGAAACAGCGAGGATAGCCGGTAAGGATAAGGGCATCAGTAAGATTCCGATTAAT TTGAAAGTGTTTTCCCCTCATGTTTTGAATCTAACGCTAGTAGATTTGCCTGGGATTACA AAGGTTCCTATTGGGGAACAACCACCTGATATTGAAAAGCAAATCAAGAATTTGATCCTA GACTATATAGCCACTCCAAATTGTTTAATCTTGGCCGTCTCTCCAGCTAACGTTGATCTT GTTAATTCTGAATCCTTAAAGTTGGCCAGAGAGGTAGACCCTCAGGGCAAAAGGACTATT GGTGTCATTACCAAATTAGATTTGATGGATTCTGGGACTAATGCTCTAGATATCTTGTCT GGAAAAATGTATCCTCTGAAATTGGGGTTTGTTGGTGTAGTGAATCGCTCGCAACAGGAT ATTCAATTGAACAAAACCGTTGAAGAATCATTGGACAAAGAAGAGGACTATTTCAGGAAA CATCCAGTCTACAGAACTATTTCAACAAAGTGTGGTACGCGTTATTTAGCTAAATTGCTA AACCAGACATTATTAAGCCACATTAGAGACAAGCTTCCGGATATTAAAACCAAGTTAAAT ACCCTGATCTCTCAAACCGAACAAGAGCTCGCTAGATACGGTGGCGTAGGAGCTACTACT AATGAAAGCAGAGCTAGCCTTGTTCTTCAACTAATGAATAAGTTTTCTACAAACTTCATT TCATCTATAGATGGTACATCCTCCGACATTAATACGAAGGAACTCTGTGGTGGTGCCCGT ATTTATTACATTTACAATAATGTTTTTGGGAATTCTTTGAAGTCGATTGATCCAACTTCT AATTTATCCGTTCTTGATGTTAGAACAGCGATTAGAAATTCTACTGGTCCCCGTCCTACA TTATTTGTACCTGAGTTGGCTTTTGACCTATTGGTTAAACCTCAAATTAAACTTTTACTA GAACCATCTCAACGTTGCGTCGAGTTAGTTTACGAGGAGCTGATGAAAATATGCCATAAA TGTGGCTCCGCTGAGCTAGCTAGATATCCTAAATTGAAGAGTATGTTAATAGAAGTTATA AGCGAACTACTTAGAGAAAGGTTACAACCTACTCGCTCTTACGTTGAAAGCTTGATTGAC ATACATCGAGCCTACATCAATACTAATCATCCTAATTTTTTAAGTGCAACAGAAGCAATG GATGACATCATGAAAACGCGTAGAAAACGGAATCAAGAGTTATTGAAAAGTAAGTTGTCT CAACAGGAGAATGGACAAACCAACGGTATTAATGGTACTTCATCTATCTCTTCGAATATA GATCAAGATTCTGCTAAAAACAGTGACTACGATGATGATGGTATCGACGCAGAATCGAAG CAAACGAAGGACAAATTTTTAAATTATTTCTTTGGCAAGGATAAAAAGGGTCAACCTGTG TTCGATGCATCAGACAAGAAAAGATCCATTGCCGGTGATGGAAATATTGAAGATTTTAGA AATTTACAAATATCAGATTTTTCACTGGGCGATATAGATGACCTTGAAAACGCTGAACCT CCACTGACCGAGAGAGAAGAATTGGAGTGCGAATTAATTAAACGTCTGATTGTTTCATAC TTTGATATTATAAGAGAAATGATTGAAGATCAAGTACCAAAGGCAGTTATGTGTTTACTC GTCAATTATTGTAAGGATTCTGTTCAAAACAGATTGGTAACCAAACTCTACAAAGAAACA CTGTTTGAAGAACTTTTAGTTGAGGATCAAACTTTAGCTCAAGATAGAGAACTATGTGTG AAATCACTCGGAGTTTATAAAAAGGCTGCAACCCTTATTAGTAATATTCTGTAA
Protein Properties
Pfam Domain Function
Protein Residues757
Protein Molecular Weight84971.0
Protein Theoretical pI5.16
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dynamin-related protein DNM1 MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI VTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWG EFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGIT KVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTI GVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRK HPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATT NESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTS NLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHK CGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEAM DDIMKTRRKRNQELLKSKLSQQENGQTNGINGTSSISSNIDQDSAKNSDYDDDGIDAESK QTKDKFLNYFFGKDKKGQPVFDASDKKRSIAGDGNIEDFRNLQISDFSLGDIDDLENAEP PLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKET LFEELLVEDQTLAQDRELCVKSLGVYKKAATLISNIL
References
External Links
ResourceLink
Saccharomyces Genome Database DNM1
Uniprot IDP54861
Uniprot NameDNM1_YEAST
GenBank Gene IDX91488
Genebank Protein ID1495224
General Reference
  • Gammie, A. E., Kurihara, L. J., Vallee, R. B., Rose, M. D. (1995). "DNM1, a dynamin-related gene, participates in endosomal trafficking in yeast." J Cell Biol 130:553-566.7622557
  • Miosga, T., Zimmermann, F. K. (1996). "Sequence analysis of the CEN12 region of Saccharomyces cerevisiae on a 43.7 kb fragment of chromosome XII including an open reading frame homologous to the human cystic fibrosis transmembrane conductance regulator protein CFTR." Yeast 12:693-708.8810043
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Bleazard, W., McCaffery, J. M., King, E. J., Bale, S., Mozdy, A., Tieu, Q., Nunnari, J., Shaw, J. M. (1999). "The dynamin-related GTPase Dnm1 regulates mitochondrial fission in yeast." Nat Cell Biol 1:298-304.10559943
  • Tieu, Q., Nunnari, J. (2000). "Mdv1p is a WD repeat protein that interacts with the dynamin-related GTPase, Dnm1p, to trigger mitochondrial division." J Cell Biol 151:353-366.11038182
  • Fukushima, N. H., Brisch, E., Keegan, B. R., Bleazard, W., Shaw, J. M. (2001). "The GTPase effector domain sequence of the Dnm1p GTPase regulates self-assembly and controls a rate-limiting step in mitochondrial fission." Mol Biol Cell 12:2756-2766.11553714
  • Cerveny, K. L., Jensen, R. E. (2003). "The WD-repeats of Net2p interact with Dnm1p and Fis1p to regulate division of mitochondria." Mol Biol Cell 14:4126-4139.14517324
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956