You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexose transporter HXT15
SynonymsNot Available
Gene NameHXT15
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionProbable glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
substrate-specific transmembrane transporter activity
transporter activity
transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 4
LocusYDL245C
Gene Sequence>1704 bp ATGGCAAGCGAACAGTCCTCACCAGAAATTAATGCAGATAATCTAAACAGTAGTGCAGCT GACGTTCATGTACAGCCACCCGGAGAGAAAGAATGGTCAGACGGGTTTTATGACAAAGAA GTCATTAATGGAAATACGCCAGACGCACCGAAGAGAGGCTTTTTAGGTTACCTTATTATC TACTTACTATGCTATCCTGTATCCTTTGGCGGTTTTTTACCTGGTTGGGATAGTGGTATT ACTGCAGGCTTCATCAATATGGATAACTTTAAAATGAATTTTGGTTCTTACAAGCACAGT ACTGGTGAGTATTATTTGAGCAACGTGCGTATGGGTCTTCTCGTGGCCATGTTCAGTGTA GGATGTTCCATTGGCGGTGTTGCTTTTGCGAGACTTGCTGATACTTTAGGTAGAAGGCTA GCAATTGTAATCGTGGTTTTGGTATATATGGTTGGTGCAATTATTCAGATCAGTTCGAAT CACAAATGGTACCAATACTTTGTCGGTAAGATCATCTACGGTCTTGGTGCTGGTGGCTGT TCGGTGTTGTGTCCAATGCTTTTATCTGAAATAGCCCCCACAGATTTGAGAGGTGGACTT GTCTCATTGTACCAACTTAACATGACCTTCGGTATTTTCTTGGGTTATTGTAGCGTTTAT GGAACAAGGAAGTATAGTAATACTGCGCAATGGAGGATTCCTGTGGGACTATGCTTTCTG TGGGCTCTAATTATCATCGTTGGCATGTTATTAGTTCCAGAGTCCCCAAGATATCTGATT GAATGTGAGAGACATGAAGAGGCCTGTGTCTCCATCGCCAAGATCAACAAGGTTTCACCA GAGGATCCATGGGTACTCAAACAGGCTGATGAAATCAACGCCGGTGTCCTTGCCCAAAGA GAACTAGGGGAAGCCTCATGGAAAGAACTTTTCTCCGTCAAAACAAAAGTCCTTCAACGT TTGATCACAGGTATTCTTGTGCAAACCTTTTTGCAACTTACTGGTGAAAACTACTTCTTC TTCTACGGAACTACCATTTTCAAATCAGTTGGGCTTACTGATGGGTTTGAGACTTCGATC GTCCTAGGTACAGTGAATTTCTTCTCCACTATTATTGCTGTTATGGTCGTAGACAAAATA GGCCGTCGTAAATGTCTGTTATTCGGAGCGGCTTCAATGATGGCTTGTATGGTCATATTT GCAAGTATCGGGGTAAAATGTCTTTACCCTCATGGCCAGGATGGTCCATCCTCGAAAGGT GCAGGTAATGCCATGATTGTGTTCACATGCTTCTATATATTCTGCTTTGCAACGACATGG GCCCCTGTTGCTTATATTGTGGTTGCCGAGTCATTCCCTTCGAAGGTCAAATCTAAAGCA ATGTCAATTTCGACTGCATTCAACTGGTTATGGCAATTCTTGATTGGTTTTTTCACACCA TTCATTACTGGGTCTATCCACTTCTATTATGGTTATGTGTTCGTAGGTTGTTTGGTTGCT ATGTTTTTGTACGTTTTCTTCTTTTTACCAGAAACAATTGGTCTATCTTTGGAGGAAATC CAGTTACTATATGAAGAAGGTATAAAACCATGGAAATCTGCATCTTGGGTACCACCCTCA AGGAGAGGAGCTTCTTCCAGGGAAACTGAGGCTAAGAAGAAAAGCTGGAAAGAAGTTTTG AAGTTCCCAAAGAGTTTTAATTGA
Protein Properties
Pfam Domain Function
Protein Residues567
Protein Molecular Weight62930.89844
Protein Theoretical pI8.17
Signalling Regions
  • None
Transmembrane Regions
  • 56-76
  • 113-133
  • 140-160
  • 171-191
  • 198-218
  • 233-253
  • 337-353
  • 360-377
  • 385-405
  • 428-448
  • 466-486
  • 488-508
Protein Sequence>Hexose transporter HXT15 MASEQSSPEINADNLNSSAADVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLII YLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSV GCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGC SVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFL WALIIIVGMLLVPESPRYLIECERHEEACVSIAKINKVSPEDPWVLKQADEINAGVLAQR ELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSI VLGTVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKG AGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTP FITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPS RRGASSRETEAKKKSWKEVLKFPKSFN
References
External Links
ResourceLink
Saccharomyces Genome Database HXT15
Uniprot IDP54854
Uniprot NameHXT15_YEAST
GenBank Gene IDX92891
Genebank Protein ID1360145
General Reference
  • Bargues, M., Salom, D., Gomez, A., Paricio, N., Perez-Alonso, M., Perez-Ortin, J. E. (1996). "Sequencing analysis of a 4.1 kb subtelomeric region from yeast chromosome IV identifies HXT15, a new member of the hexose transporter family." Yeast 12:1005-1011.8896264
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258