You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydroxyacetone kinase 1
Synonyms
  • DHA kinase 1
  • Glycerone kinase 1
Gene NameDAK1
Enzyme Class
Biological Properties
General FunctionInvolved in glycerone kinase activity
Specific FunctionATP + glycerone = ADP + glycerone phosphate
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Glycerolipid metabolismec00561 Map00561
Methane metabolismec00680 Map00680
SMPDB ReactionsNot Available
KEGG Reactions
Dihydroxyacetone + Adenosine triphosphateDihydroxyacetone phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00018DihydroxyacetoneShow
YMDB00109Adenosine triphosphateShow
YMDB00322Dihydroxyacetone phosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
glycerone kinase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
catalytic activity
kinase activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
polyol metabolic process
alditol metabolic process
glycerol metabolic process
small molecule metabolic process
metabolic process
alcohol metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYML070W
Gene Sequence>1755 bp ATGTCCGCTAAATCGTTTGAAGTCACAGATCCAGTCAATTCAAGTCTCAAAGGGTTTGCC CTTGCTAACCCCTCCATTACGCTGGTCCCTGAAGAAAAAATTCTCTTCAGAAAGACCGAT TCCGACAAGATCGCATTAATTTCTGGTGGTGGTAGTGGACATGAACCTACACACGCCGGT TTCATTGGTAAGGGTATGTTGAGTGGCGCCGTGGTTGGCGAAATTTTTGCATCCCCTTCA ACAAAACAGATTTTAAATGCAATCCGTTTAGTCAATGAAAATGCGTCTGGCGTTTTATTG ATTGTGAAGAACTACACAGGTGATGTTTTGCATTTTGGTCTGTCCGCTGAGAGAGCAAGA GCCTTGGGTATTAACTGCCGCGTTGCTGTCATAGGTGATGATGTTGCAGTTGGCAGAGAA AAGGGTGGTATGGTTGGTAGAAGAGCATTGGCAGGTACCGTTTTGGTTCATAAGATTGTA GGTGCCTTCGCAGAAGAATATTCTAGTAAGTATGGCTTAGACGGTACAGCTAAAGTGGCT AAAATTATCAACGACAATTTGGTGACCATTGGATCTTCTTTAGACCATTGTAAAGTTCCT GGCAGGAAATTCGAAAGTGAATTAAACGAAAAACAAATGGAATTGGGTATGGGTATTCAT AACGAACCTGGTGTGAAAGTTTTAGACCCTATTCCTTCTACCGAAGACTTGATCTCCAAG TATATGCTACCAAAACTATTGGATCCAAACGATAAGGATAGAGCTTTTGTAAAGTTTGAT GAAGATGATGAAGTTGTCTTGTTAGTTAACAATCTCGGCGGTGTTTCTAATTTTGTTATT AGTTCTATCACTTCCAAAACTACGGATTTCTTAAAGGAAAATTACAACATAACCCCGGTT CAAACAATTGCTGGCACATTGATGACCTCCTTCAATGGTAATGGGTTCAGTATCACATTA CTAAACGCCACTAAGGCTACAAAGGCTTTGCAATCTGATTTTGAGGAGATCAAATCAGTA CTAGACTTGTTGAACGCATTTACGAACGCACCGGGCTGGCCAATTGCAGATTTTGAAAAG ACTTCTGCCCCATCTGTTAACGATGACTTGTTACATAATGAAGTAACAGCAAAGGCCGTC GGTACCTATGACTTTGACAAGTTTGCTGAGTGGATGAAGAGTGGTGCTGAACAAGTTATC AAGAGCGAACCGCACATTACGGAACTAGACAATCAAGTTGGTGATGGTGATTGTGGTTAC ACTTTAGTGGCAGGAGTTAAAGGCATCACCGAAAACCTTGACAAGCTGTCGAAGGACTCA TTATCTCAGGCGGTTGCCCAAATTTCAGATTTCATTGAAGGCTCAATGGGAGGTACTTCT GGTGGTTTATATTCTATTCTTTTGTCGGGTTTTTCACACGGATTAATTCAGGTTTGTAAA TCAAAGGATGAACCCGTCACTAAGGAAATTGTGGCTAAGTCACTCGGAATTGCATTGGAT ACTTTATACAAATATACAAAGGCAAGGAAGGGATCATCCACCATGATTGATGCTTTAGAA CCATTCGTTAAAGAATTTACTGCATCTAAGGATTTCAATAAGGCGGTAAAAGCTGCAGAG GAAGGTGCTAAATCCACTGCTACATTCGAGGCCAAATTTGGCAGAGCTTCGTATGTCGGC GATTCATCTCAAGTAGAAGATCCTGGTGCAGTAGGCCTATGTGAGTTTTTGAAGGGGGTT CAAAGCGCCTTGTAA
Protein Properties
Pfam Domain Function
Protein Residues584
Protein Molecular Weight62206.10156
Protein Theoretical pI5.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dihydroxyacetone kinase 1 MSAKSFEVTDPVNSSLKGFALANPSITLVPEEKILFRKTDSDKIALISGGGSGHEPTHAG FIGKGMLSGAVVGEIFASPSTKQILNAIRLVNENASGVLLIVKNYTGDVLHFGLSAERAR ALGINCRVAVIGDDVAVGREKGGMVGRRALAGTVLVHKIVGAFAEEYSSKYGLDGTAKVA KIINDNLVTIGSSLDHCKVPGRKFESELNEKQMELGMGIHNEPGVKVLDPIPSTEDLISK YMLPKLLDPNDKDRAFVKFDEDDEVVLLVNNLGGVSNFVISSITSKTTDFLKENYNITPV QTIAGTLMTSFNGNGFSITLLNATKATKALQSDFEEIKSVLDLLNAFTNAPGWPIADFEK TSAPSVNDDLLHNEVTAKAVGTYDFDKFAEWMKSGAEQVIKSEPHITELDNQVGDGDCGY TLVAGVKGITENLDKLSKDSLSQAVAQISDFIEGSMGGTSGGLYSILLSGFSHGLIQVCK SKDEPVTKEIVAKSLGIALDTLYKYTKARKGSSTMIDALEPFVKEFTASKDFNKAVKAAE EGAKSTATFEAKFGRASYVGDSSQVEDPGAVGLCEFLKGVQSAL
References
External Links
ResourceLink
Saccharomyces Genome Database DAK1
Uniprot IDP54838
Uniprot NameDAK1_YEAST
GenBank Gene IDZ38114
Genebank Protein ID558404
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Norbeck, J., Blomberg, A. (1997). "Metabolic and regulatory changes associated with growth of Saccharomyces cerevisiae in 1.4 M NaCl. Evidence for osmotic induction of glycerol dissimilation via the dihydroxyacetone pathway." J Biol Chem 272:5544-5554.9038161
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956