You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-arabinono-1,4-lactone oxidase
Synonyms
  • ALO
  • L-galactono-gamma-lactone oxidase
Gene NameALO1
Enzyme Class
Biological Properties
General FunctionInvolved in D-arabinono-1,4-lactone oxidase activity
Specific FunctionCan oxidize L-gulono-1,4-lactone as well as D-arabinono- 1,4-lactone and L-galactono-1,4-lactone
Cellular LocationMitochondrion membrane.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
D-arabinono-1,4-lactone + oxygenHydrogen peroxide + dehydro-D-arabinono-1,4-lactone
Metabolites
YMDB IDNameView
YMDB00014D-arabinono-1,4-lactoneShow
YMDB00192dehydro-D-arabinono-1,4-lactoneShow
YMDB00888Hydrogen peroxideShow
YMDB00900oxygenShow
GO Classification
Component
cell part
membrane
Function
catalytic activity
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, oxygen as acceptor
D-arabinono-1,4-lactone oxidase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
Process
oxidation reduction
metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 13
LocusYML086C
Gene Sequence>1581 bp ATGTCTACTATCCCATTTAGAAAGAACTATGTGTTCAAAAACTGGGCCGGAATTTATTCT GCAAAACCAGAACGTTACTTCCAACCAAGTTCAATTGATGAGGTTGTCGAGTTAGTAAAG AGTGCCAGGCTAGCTGAAAAAAGCTTAGTTACTGTTGGTTCGGGCCATTCTCCTAGTAAC ATGTGCGTTACTGATGAATGGCTTGTTAACTTAGACAGATTGGACAAAGTACAAAAGTTT GTTGAATATCCTGAGTTACATTATGCCGATGTCACAGTTGATGCCGGTATGAGGCTTTAC CAATTGAATGAATTTTTGGGTGCGAAAGGTTACTCTATCCAAAATTTAGGCTCTATCTCA GAACAAAGTGTTGCTGGCATAATCTCTACTGGTAGTCATGGTTCCTCACCTTATCACGGT TTGATTTCTTCTCAATACGTAAACTTGACTATTGTTAATGGTAAGGGCGAATTGAAGTTC TTGGATGCCGAAAACGATCCAGAAGTCTTTAAAGCTGCTTTACTTTCAGTTGGAAAAATC GGTATCATTGTCTCTGCTACTATCAGGGTTGTTCCCGGCTTCAATATTAAATCCACTCAA GAAGTGATTACTTTTGAAAACCTTTTGAAGCAATGGGATACCCTATGGACTTCATCTGAA TTTATCAGAGTTTGGTGGTACCCTTATACTAGAAAATGTGTTCTATGGAGGGGTAACAAA ACTACAGATGCCCAAAATGGTCCAGCCAAGTCATGGTGGGGTACCAAGCTGGGTAGATTT TTCTACGAAACTCTATTATGGATCTCTACCAAAATCTATGCGCCATTAACCCCATTTGTG GAAAAGTTCGTTTTCAACAGGCAATACGGGAAATTGGAGAAGAGCTCTACTGGTGATGTT AATGTTACCGATTCTATCAGCGGATTTAATATGGACTGTTTGTTTTCACAATTTGTTGAT GAATGGGGGTGCCCTATGGATAATGGTTTGGAAGTCTTACGTTCATTGGATCATTCTATT GCGCAGGCTGCCATAAACAAAGAATTTTATGTCCACGTGCCTATGGAAGTCCGTTGCTCA AATACTACATTACCTTCTGAACCCTTGGATACTAGCAAGAGAACAAACACCAGTCCCGGT CCCGTTTATGGCAATGTGTGCCGCCCATTCCTGGATAACACACCATCCCATTGCAGATTT GCTCCGTTGGAAAATGTTACCAACAGTCAGTTGACGTTGTACATAAATCCTACCATTTAT AGGCCGTTTGGCTGTAATACTCCAATTCATAAATGGTTTACCCTTTTTGAAAATACTATG ATGGTAGCGGGAGGTAAGCCACATTGGGCCAAGAACTTCCTAGGCTCAACCACTCTAGCT GCTGGACCAGTGAAAAAGGATACTGATTACGATGACTTTGAAATGAGGGGGATGGCATTG AAGGTTGAAGAATGGTATGGCGAGGATTTGAAAAAGTTCCGGAAAATAAGAAAGGAGCAA GATCCCGATAATGTATTCTTGGCAAACAAACAGTGGGCTATCATAAATGGTATTATAGAT CCTAGTGAGTTGTCCGACTAG
Protein Properties
Pfam Domain Function
Protein Residues526
Protein Molecular Weight59493.19922
Protein Theoretical pI6.78
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-arabinono-1,4-lactone oxidase MSTIPFRKNYVFKNWAGIYSAKPERYFQPSSIDEVVELVKSARLAEKSLVTVGSGHSPSN MCVTDEWLVNLDRLDKVQKFVEYPELHYADVTVDAGMRLYQLNEFLGAKGYSIQNLGSIS EQSVAGIISTGSHGSSPYHGLISSQYVNLTIVNGKGELKFLDAENDPEVFKAALLSVGKI GIIVSATIRVVPGFNIKSTQEVITFENLLKQWDTLWTSSEFIRVWWYPYTRKCVLWRGNK TTDAQNGPAKSWWGTKLGRFFYETLLWISTKIYAPLTPFVEKFVFNRQYGKLEKSSTGDV NVTDSISGFNMDCLFSQFVDEWGCPMDNGLEVLRSLDHSIAQAAINKEFYVHVPMEVRCS NTTLPSEPLDTSKRTNTSPGPVYGNVCRPFLDNTPSHCRFAPLENVTNSQLTLYINATIY RPFGCNTPIHKWFTLFENTMMVAGGKPHWAKNFLGSTTLAAGPVKKDTDYDDFEMRGMAL KVEEWYGEDLKKFRKIRKEQDPDNVFLANKQWAIINGIIDPSELSD
References
External Links
ResourceLink
Saccharomyces Genome Database ALO1
Uniprot IDP54783
Uniprot NameALO_YEAST
GenBank Gene IDAB009401
Genebank Protein ID2696034
General Reference
  • Huh, W. K., Lee, B. H., Kim, S. T., Kim, Y. R., Rhie, G. E., Baek, Y. W., Hwang, C. S., Lee, J. S., Kang, S. O. (1998). "D-Erythroascorbic acid is an important antioxidant molecule in Saccharomyces cerevisiae." Mol Microbiol 30:895-903.10094636
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106