You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMagnesium-activated aldehyde dehydrogenase, cytosolic
Synonyms
  • Mg(2+)-activated acetaldehyde dehydrogenase
  • Mg(2+)-ACDH
Gene NameALD6
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionAn aldehyde + NAD(+) + H(2)O = an acid + NADH
Cellular LocationCytoplasm
SMPDB Pathways
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
threonine metabolismPW002401 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Fatty acid metabolismec00071 Map00071
Glycerolipid metabolismec00561 Map00561
Glycolysis / Gluconeogenesisec00010 Map00010
Histidine metabolismec00340 Map00340
SMPDB Reactions
Acetaldehyde + NAD + Coenzyme ANADH + hydron + Acetyl-CoA
KEGG Reactions
NADP + Acetaldehyde + waterAcetic acid + NADPH + hydron
Indoleacetaldehyde + NADP + waterNADPH + hydron + indole-3-acetate
Metabolites
YMDB IDNameView
YMDB00022AcetaldehydeShow
YMDB00045Coenzyme AShow
YMDB00056Acetic acidShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00312Acetyl-CoAShow
YMDB00354IndoleacetaldehydeShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00576indole-3-acetateShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL061W
Gene Sequence>1503 bp ATGACTAAGCTACACTTTGACACTGCTGAACCAGTCAAGATCACACTTCCAAATGGTTTG ACATACGAGCAACCAACCGGTCTATTCATTAACAACAAGTTTATGAAAGCTCAAGACGGT AAGACCTATCCCGTCGAAGATCCTTCCACTGAAAACACCGTTTGTGAGGTCTCTTCTGCC ACCACTGAAGATGTTGAATATGCTATCGAATGTGCCGACCGTGCTTTCCACGACACTGAA TGGGCTACCCAAGACCCAAGAGAAAGAGGCCGTCTACTAAGTAAGTTGGCTGACGAATTG GAAAGCCAAATTGACTTGGTTTCTTCCATTGAAGCTTTGGACAATGGTAAAACTTTGGCC TTAGCCCGTGGGGATGTTACCATTGCAATCAACTGTCTAAGAGATGCTGCTGCCTATGCC GACAAAGTCAACGGTAGAACAATCAACACCGGTGACGGCTACATGAACTTCACCACCTTA GAGCCAATCGGTGTCTGTGGTCAAATTATTCCATGGAACTTTCCAATAATGATGTTGGCT TGGAAGATCGCCCCAGCATTGGCCATGGGTAACGTCTGTATCTTGAAACCCGCTGCTGTC ACACCTTTAAATGCCCTATACTTTGCTTCTTTATGTAAGAAGGTTGGTATTCCAGCTGGT GTCGTCAACATCGTTCCAGGTCCTGGTAGAACTGTTGGTGCTGCTTTGACCAACGACCCA AGAATCAGAAAGCTGGCTTTTACCGGTTCTACAGAAGTCGGTAAGAGTGTTGCTGTCGAC TCTTCTGAATCTAACTTGAAGAAAATCACTTTGGAACTAGGTGGTAAGTCCGCCCATTTG GTCTTTGACGATGCTAACATTAAGAAGACTTTACCAAATCTAGTAAACGGTATTTTCAAG AACGCTGGTCAAATTTGTTCCTCTGGTTCTAGAATTTACGTTCAAGAAGGTATTTACGAC GAACTATTGGCTGCTTTCAAGGCTTACTTGGAAACCGAAATCAAAGTTGGTAATCCATTT GACAAGGCTAACTTCCAAGGTGCTATCACTAACCGTCAACAATTCGACACAATTATGAAC TACATCGATATCGGTAAGAAAGAAGGCGCCAAGATCTTAACTGGTGGCGAAAAAGTTGGT GACAAGGGTTACTTCATCAGACCAACCGTTTTCTACGATGTTAATGAAGACATGAGAATT GTTAAGGAAGAAATTTTTGGACCAGTTGTCACTGTCGCAAAGTTCAAGACTTTAGAAGAA GGTGTCGAAATGGCTAACAGCTCTGAATTCGGTCTAGGTTCTGGTATCGAAACAGAATCT TTGAGCACAGGTTTGAAGGTGGCCAAGATGTTGAAGGCCGGTACCGTCTGGATCAACACA TACAACGATTTTGACTCCAGAGTTCCATTCGGTGGTGTTAAGCAATCTGGTTACGGTAGA GAAATGGGTGAAGAAGTCTACCATGCATACACTGAAGTAAAAGCTGTCAGAATTAAGTTG TAA
Protein Properties
Pfam Domain Function
Protein Residues500
Protein Molecular Weight54413.69922
Protein Theoretical pI5.08
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Magnesium-activated aldehyde dehydrogenase, cytosolic MTKLHFDTAEPVKITLPNGLTYEQPTGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSSA TTEDVEYAIECADRAFHDTEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTLA LARGDVTIAINCLRDAAAYADKVNGRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLA WKIAPALAMGNVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDP RIRKLAFTGSTEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNGIFK NAGQICSSGSRIYVQEGIYDELLAAFKAYLETEIKVGNPFDKANFQGAITNRQQFDTIMN YIDIGKKEGAKILTGGEKVGDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKTLEE GVEMANSSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGR EMGEEVYHAYTEVKAVRIKL
References
External Links
ResourceLink
Saccharomyces Genome Database ALD6
Uniprot IDP54115
Uniprot NameALDH6_YEAST
GenBank Gene IDU39205
Genebank Protein ID1079681
General Reference
  • Wang, X., Mann, C. J., Bai, Y., Ni, L., Weiner, H. (1998). "Molecular cloning, characterization, and potential roles of cytosolic and mitochondrial aldehyde dehydrogenases in ethanol metabolism in Saccharomyces cerevisiae." J Bacteriol 180:822-830.9473035
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Norbeck, J., Blomberg, A. (1997). "Metabolic and regulatory changes associated with growth of Saccharomyces cerevisiae in 1.4 M NaCl. Evidence for osmotic induction of glycerol dissimilation via the dihydroxyacetone pathway." J Biol Chem 272:5544-5554.9038161
  • Meaden, P. G., Dickinson, F. M., Mifsud, A., Tessier, W., Westwater, J., Bussey, H., Midgley, M. (1997). "The ALD6 gene of Saccharomyces cerevisiae encodes a cytosolic, Mg(2+)-activated acetaldehyde dehydrogenase." Yeast 13:1319-1327.9392076
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956