You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCysteinyl-tRNA synthetase
Synonyms
  • Cysteine--tRNA ligase
  • CysRS
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys)
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + tRNA(Cys) + L-CysteineAdenosine monophosphate + Pyrophosphate + Cys-tRNA(Cys)
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
cysteine-tRNA ligase activity
binding
nucleotide binding
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
Process
cellular macromolecule biosynthetic process
translation
biosynthetic process
cysteinyl-tRNA aminoacylation
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
tRNA aminoacylation for protein translation
macromolecule metabolic process
macromolecule biosynthetic process
Gene Properties
Chromosome LocationNot Available
LocusYNL247W
Gene Sequence>2304 bp ATGAATATCTTCATAAAAGCCCTGAGAAGATATACTATAATGTCTACGCCGAAGATTGTG CAGCCCAAATGGAAGGTTCCAACGCCACAAGCTAAAGAAACTGTGTTGAAGTTGTACAAC AGTTTAACAAGATCTAAGGTTGAATTCATTCCGCAATCTGGCAATAGAGGTGTCACTTGG TACTCTTGCGGTCCTACTGTTTACGATGCCTCCCATATGGGTCATGCCAGAAACTATGTC TCTATTGATATCAATAGAAGAATTATTCAAGATTATTTTGGTTACGACGTGCAATTTGTG CAAAATGTTACTGATATCGACGATAAAATTATTTTGAGAGCTAGACAAAACTATTTATTT GACAATTTTGTCAAAGAAAATGATACCAAATTCAACGCCACTGTTGTTGACAAGGTCAAA ACCGCACTTTTCCAATATATCAACAAAAATTTTACTATTCAAGGCAGCGAGATCAAAACT ATCGAAGAATTTGAAACTTGGTTATCGAATGCTGATACTGAAACTTTAAAATTGGAGAAT CCTAAATTCCCTATGCATGTCACCGCAGTTCAAAATGCTATTGAATCAATCACTAAGGGC GATTCCATGGACGCAGAAGTTGCCTTTGAAAAAGTCAAGGACGTTACGGTTCCTCTATTG GATAAAGAATTGGGCTCTACCATTAGCAATCCAGAGATTTTCCGCCAACTTCCAGCTTAC TGGGAACAGAAATTCAATGATGACATGTTATCATTAAACGTGCTACCTCCCACCGTTACA ACTCGTGTTTCTGAGTACGTTCCAGAAATTATTGACTTTGTTCAAAAAATTATTGATAAT GGTTACGCATATGCCACTTCCGACGGTTCCGTGTACTTTGATACTTTAAAATTTGACAAA TCCCCAAATCATGACTATGCTAAATGCCAGCCATGGAATAAGGGCCAGTTAGACTTAATT AATGATGGTGAAGGGTCCTTAAGCAACTTTGCTGATAACGGAAAAAAGTCGAATAATGAT TTTGCTTTATGGAAGGCTTCCAAGGCAGGTGAACCTGAGTGGGAATCACCATGGGGTAAG GGTAGACCAGGATGGCATATTGAATGTTCTGTGATGGCCAGTGATATCCTAGGCTCTAAC ATCGATATTCATTCAGGTGGCATCGATTTGGCCTTTCCTCACCATGATAACGAATTGGCT CAATCCGAGGCTCGCTTCGACAATCAACAGTGGATCAACTATTTCTTACATACGGGCCAT TTACATATTGAGGGTCAAAAAATGTCTAAATCCTTAAAGAATTTCATTACCATTCAAGAA GCTTTGAAAAAATTCTCACCGCGCCAATTAAGATTGGCTTTTGCCTCAGTACAATGGAAC AATCAATTGGATTTCAAGGAATCTTTGATCCATGAAGTAAAGTCATTTGAAAACTCCATG AACAATTTTTTTAAGACTATTAGAGCATTGAAGAACGATGCAGCTTCTGCAGGTCATATC TCTAAAAAGTTTAGTCCCTTAGAGAAAGAATTATTGGCTGATTTTGTTGAAAGTGAATCG AAAGTCCATTCGGCGTTCTGTGATAATTTATCCACACCTGTTGCTTTGAAGACACTGAGC GAATTAGTGACCAAGTCAAACACATACATTACCACTGCAGGTGCTGCTTTAAAAATTGAG CCCTTGATTGCTATCTGTAGCTACATCACCAAAATCTTAAGAATAATTGGATTTCCATCC CGTCCTGACAATTTGGGTTGGGCAGCCCAAGCTGGCTCCAACGATGGATCCCTAGGCTCA TTGGAAGACACTGTTATGCCATATGTTAAGTGTTTATCCACATTTAGAGATGATGTACGT TCCTTAGCTATCAAGAAAGCCGAACCCAAGGAATTCTTGCAATTAACGGATAAAATTAGA AACGAAGATTTGCTAAACTTGAATGTTGCCTTGGATGATAGGAATGGACAATCTGCCTTG ATCAAATTTTTGACTAACGATGAAAAATTGGAAATTGTCAAGCTAAACGAGGAGAAACAT GCCAACGAACTAGCAAAGAAACAAAAGAAATTGGAACAGCAGAAATTAAGAGAGCAGAAG GAAAACGAGAGGAAGCAGAAAGCTCAAATTAAACCACAAGATATGTTCAAGGATGTCACA TTGTACAGTGCTTGGGACGAGCAAGGCCTTCCAACAAAGGACAAAGACGGTAATGATATC ACCAAGAGTATGACCAAGAAGTTGAAGAAGCAATGGGAACAACAAAAGAAGCTACATGAA GAGTACTTTGGTGAAGACAAATAG
Protein Properties
Pfam Domain Function
Protein Residues767
Protein Molecular Weight87529.5
Protein Theoretical pI6.84
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cysteinyl-tRNA synthetase MNIFIKALRRYTIMSTPKIVQPKWKVPTPQAKETVLKLYNSLTRSKVEFIPQSGNRGVTW YSCGPTVYDASHMGHARNYVSIDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLF DNFVKENDTKFNATVVDKVKTALFQYINKNFTIQGSEIKTIEEFETWLSNADTETLKLEN PKFPMHVTAVQNAIESITKGDSMDAEVAFEKVKDVTVPLLDKELGSTISNPEIFRQLPAY WEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDK SPNHDYAKCQPWNKGQLDLINDGEGSLSNFADNGKKSNNDFALWKASKAGEPEWESPWGK GRPGWHIECSVMASDILGSNIDIHSGGIDLAFPHHDNELAQSEARFDNQQWINYFLHTGH LHIEGQKMSKSLKNFITIQEALKKFSPRQLRLAFASVQWNNQLDFKESLIHEVKSFENSM NNFFKTIRALKNDAASAGHISKKFSPLEKELLADFVESESKVHSAFCDNLSTPVALKTLS ELVTKSNTYITTAGAALKIEPLIAICSYITKILRIIGFPSRPDNLGWAAQAGSNDGSLGS LEDTVMPYVKCLSTFRDDVRSLAIKKAEPKEFLQLTDKIRNEDLLNLNVALDDRNGQSAL IKFLTNDEKLEIVKLNEEKHANELAKKQKKLEQQKLREQKENERKQKAQIKPQDMFKDVT LYSAWDEQGLPTKDKDGNDITKSMTKKLKKQWEQQKKLHEEYFGEDK
References
External Links
ResourceLink
Saccharomyces Genome Database YNL247W
Uniprot IDP53852
Uniprot NameSYC_YEAST
GenBank Gene IDX96722
Genebank Protein ID1255971
General Reference
  • Sen-Gupta, M., Guldener, U., Beinhauer, J., Fiedler, T., Hegemann, J. H. (1997). "Sequence analysis of the 33 kb long region between ORC5 and SUI1 from the left arm of chromosome XIV from Saccharomyces cerevisiae." Yeast 13:849-860.9234673
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Motorin, Y., Le Caer, J. P., Waller, J. P. (1997). "Cysteinyl-tRNA synthetase from Saccharomyces cerevisiae. Purification, characterization and assignment to the genomic sequence YNL247w." Biochimie 79:731-740.9523015
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956