You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDethiobiotin synthetase
Synonyms
  • DTB synthetase
  • Dethiobiotin synthase
  • DTBS
Gene NameBIO4
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionATP + 7,8-diaminononanoate + CO(2) = ADP + phosphate + dethiobiotin
Cellular LocationNot Available
SMPDB Pathways
Biotin BiosynthesisPW002380 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biotin metabolismec00780 Map00780
SMPDB Reactions
Diaminopimelic acid + Adenosine triphosphate + Carbon dioxideADP + phosphate + hydron + Dethiobiotin
KEGG Reactions
7,8-diaminononanoic acid + Adenosine triphosphate + Carbon dioxideDethiobiotin + phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00075DethiobiotinShow
YMDB001027,8-diaminononanoic acidShow
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00912Carbon dioxideShow
YMDB00914ADPShow
YMDB16140Diaminopimelic acidShow
GO Classification
Component
Not Available
Function
metal ion binding
magnesium ion binding
cyclo-ligase activity
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
dethiobiotin synthase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ion binding
cation binding
Process
small molecule metabolic process
vitamin metabolic process
metabolic process
water-soluble vitamin metabolic process
biotin metabolic process
biotin biosynthetic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNR057C
Gene Sequence>714 bp ATGAACAGCAAATCTCAACAACAAGAACAACAACCAATTGTATTCGTCACCGGTACAGAC ACTGATGTTGGTAAAACCTTTGTATCAACATTATTGGTACACAAATGGAAAGCTGCATAC TGGAAACCCGTACAAACTGGAATTGAGTCAGATCAAGGTGACTCCGAGACATTGAAAAAT TTCAAAATAGCCGCATCAACTTGGCAACCACCTATATTCACGCCCACTTATGCGCTGCAG AAGCCTCTATCTCCGCTCCAGGCCATGGAGTACGAACCTAATGTCGACATCAGGTTGTTG GATTTCGTAGTTCCTGAAGAGTGGAGCGCAGAGAATCCATTGGTCGTAGAAGGAGCCGGC GGGGTTTGCGTTCCTATCACTCGTAAATTGGAAATTACGACGGATCTAATTAAACATCTG ATTGAGACTAGCGGCCATCCAGTGTACGTAGTTGTCGTGGCACGCAGCGGGCTAGGGACT CTGAATCATACATTGCTGACTTGGAATCATCTTTGCGATAATGGCTTGAGAAGCCACCTT TTTGGGGTCATTCTCAATGGGGAACCGAATGAAGGCAACGTGCAGGCCCTGAAGAAGTTC GGTGTCAATATTATGGCACAGGTTGCACAATGTACTACGGCACATGATCAGGATATGGAG TTGCATGAACTGCCATCGGTGGAGTCATTAATGACCCAACAAGACGTAGAATAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues237
Protein Molecular Weight26256.69922
Protein Theoretical pI4.79
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dethiobiotin synthetase MNSKSQQQEQQPIVFVTGTDTDVGKTFVSTLLVHKWKAAYWKPVQTGIESDQGDSETLKN FKIAASTWQPPIFTPTYALQKPLSPLQAMEYEPNVDIRLLDFVVPEEWSAENPLVVEGAG GVCVPITRKLEITTDLIKHLIETSGHPVYVVVVARSGLGTLNHTLLTWNHLCDNGLRSHL FGVILNGEPNEGNVQALKKFGVNIMAQVAQCTTAHDQDMELHELPSVESLMTQQDVE
References
External Links
ResourceLink
Saccharomyces Genome Database BIO4
Uniprot IDP53630
Uniprot NameBIOD_YEAST
GenBank Gene IDAY558424
Genebank Protein ID45270738
General Reference
  • Phalip, V., Kuhn, I., Lemoine, Y., Jeltsch, J. M. (1999). "Characterization of the biotin biosynthesis pathway in Saccharomyces cerevisiae and evidence for a cluster containing BIO5, a novel gene involved in vitamer uptake." Gene 232:43-51.10333520
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287