You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSuccinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial
Synonyms
  • Succinyl-CoA synthetase subunit alpha
  • SCS-alpha
Gene NameLSC1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionATP + succinate + CoA = ADP + phosphate + succinyl-CoA
Cellular LocationMitochondrion
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Propanoate metabolismec00640 Map00640
SMPDB Reactions
Succinyl-CoA + phosphate + Guanosine diphosphateSuccinic acid + Coenzyme A + GTP
Adenosine triphosphate + itaconic acid + Coenzyme AADP + phosphate + itaconyl-CoA
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00109Adenosine triphosphateShow
YMDB00257Guanosine diphosphateShow
YMDB00338Succinic acidShow
YMDB00514Succinyl-CoAShow
YMDB00558GTPShow
YMDB00716itaconic acidShow
YMDB00717itaconyl-CoAShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
succinate-CoA ligase (ADP-forming) activity
ATP citrate synthase activity
catalytic activity
transferase activity
ligase activity
binding
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
ligase activity, forming carbon-sulfur bonds
CoA-ligase activity
succinate-CoA ligase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR142W
Gene Sequence>990 bp ATGTTAAGATCTACCGTTTCAAAAGCTTCTCTCAAAATTTGTCGTCACTTTCACAGAGAA TCTATTCCTTACGATAAGACGATCAAAAATTTGCTGCTTCCCAAGGACACCAAGGTGATC TTTCAGGGGTTCACAGGTAAACAAGGTACTTTTCATGCCAGCATCTCTCAAGAATATGGT ACAAATGTTGTGGGTGGTACGAACCCAAAAAAGGCGGGTCAAACACATTTAGGCCAACCT GTCTTTGCCTCTGTGAAGGACGCGATTAAGGAGACTGGAGCCACTGCCAGTGCCATCTTT GTTCCTCCACCGATCGCAGCTGCTGCCATTAAAGAATCTATTGAAGCTGAAATTCCGTTA GCTGTATGTATCACTGAAGGTATTCCTCAACATGACATGTTATACATTGCAGAAATGTTG CAGACACAAGATAAAACAAGATTAGTTGGGCCCAACTGCCCTGGTATCATTAACCCAGCA ACAAAGGTAAGAATTGGTATCCAGCCCCCAAAAATTTTTCAAGCTGGTAAAATCGGTATT ATTTCCAGATCGGGAACTTTGACATACGAAGCTGTTCAGCAAACTACAAAAACTGACCTT GGTCAATCACTGGTTATTGGTATGGGTGGTGATGCTTTTCCCGGTACTGATTTTATTGAC GCCTTGAAATTATTTCTAGAAGATGAAACTACAGAAGGTATTATTATGTTAGGTGAAATA GGTGGTAAGGCCGAAATCGAAGCTGCTCAATTTCTCAAAGAATACAACTTTAGCAGGAGT AAGCCGATGCCGGTGGCATCTTTCATCGCAGGAACTGTTGCTGGTCAAATGAAAGGTGTT AGAATGGGTCACTCCGGTGCAATTGTAGAAGGATCTGGAACTGATGCAGAATCCAAAAAA CAAGCTTTGAGAGATGTTGGTGTTGCCGTCGTTGAATCTCCAGGTTACTTAGGTCAAGCT TTACTGGATCAATTTGCCAAATTTAAATGA
Protein Properties
Pfam Domain Function
Protein Residues329
Protein Molecular Weight35032.19922
Protein Theoretical pI8.76
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial MLRSTVSKASLKICRHFHRESIPYDKTIKNLLLPKDTKVIFQGFTGKQGTFHASISQEYG TNVVGGTNPKKAGQTHLGQPVFASVKDAIKETGATASAIFVPPPIAAAAIKESIEAEIPL AVCITEGIPQHDMLYIAEMLQTQDKTRLVGPNCPGIINPATKVRIGIQPPKIFQAGKIGI ISRSGTLTYEAVQQTTKTDLGQSLVIGMGGDAFPGTDFIDALKLFLEDETTEGIIMLGEI GGKAEIEAAQFLKEYNFSRSKPMPVASFIAGTVAGQMKGVRMGHSGAIVEGSGTDAESKK QALRDVGVAVVESPGYLGQALLDQFAKFK
References
External Links
ResourceLink
Saccharomyces Genome Database LSC1
Uniprot IDP53598
Uniprot NameSUCA_YEAST
GenBank Gene IDX94335
Genebank Protein ID1164984
General Reference
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Przybyla-Zawislak, B., Dennis, R. A., Zakharkin, S. O., McCammon, M. T. (1998). "Genes of succinyl-CoA ligase from Saccharomyces cerevisiae." Eur J Biochem 258:736-743.9874242
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956