You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDicarboxylic amino acid permease
SynonymsNot Available
Gene NameDIP5
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionCan transport glutamate, aspartate, glutamine, asparagine, serine, alanine and glycine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00016GlycineShow
YMDB00112L-SerineShow
YMDB00154L-AlanineShow
YMDB00226L-AsparagineShow
YMDB00271L-Glutamic acidShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
amine transmembrane transporter activity
amino acid transmembrane transporter activity
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 16
LocusYPL265W
Gene Sequence>1827 bp ATGAAGATGCCTCTAAAGAAGATGTTTACCAGCACGTCTCCTCGTAACTCTTCTTCTCTT GACAGTGATCATGACGCTTACTATTCGAAACAAAATCCTGACAATTTCCCTGTAAAGGAG CAAGAAATCTATAACATTGACCTGGAAGAAAACAATGTGTCCTCTCGTTCATCCACCTCT ACATCACCTTCAGCAAGGGACGACTCTTTCGCAGTTCCAGATGGTAAAGACGAAAACACG CGGTTGAGGAAAGATTTAAAGGCAAGACATATTTCTATGATCGCCATTGGTGGTTCATTA GGTACAGGTCTGCTTATAGGTACAGGTACCGCCTTATTGACGGGTGGTCCGGTTGCGATG TTAATTGCATATGCCTTTGTCGGCCTTTTAGTCTTTTACACCATGGCCTGTCTTGGTGAA ATGGCTTCTTACATTCCATTGGATGGTTTTACAAGTTATGCCTCACGTTACGTGGATCCT GCATTAGGTTTTGCTATTGGTTATACTTACCTTTTCAAATATTTCATCTTACCTCCCAAC CAACTTACTGCTGCTGCTTTGGTCATTCAATATTGGATCAGCAGAGACCGTGTTAACCCT GGTGTGTGGATTACTATATTCTTGGTTGTTATTGTCGCTATCAATGTCGTCGGTGTAAAA TTCTTTGGTGAATTTGAATTTTGGTTGTCCAGTTTCAAAGTCATGGTAATGTTGGGTCTA ATCCTGTTACTATTTATTATTATGCTTGGTGGAGGTCCTAACCATGACCGCCTAGGGTTT AGATACTGGCGTGATCCTGGTGCGTTCAAAGAATATTCGACGGCTATCACTGGTGGTAAA GGTAAATTTGTTTCGTTCGTTGCTGTTTTCGTTTACAGTCTTTTCAGTTACACGGGTATT GAATTGACAGGTATCGTTTGTTCTGAAGCTGAGAATCCAAGAAAAAGTGTTCCAAAGGCA ATTAAATTGACAGTTTACCGTATCATTGTTTTTTACCTATGCACCGTTTTCCTTTTGGGT ATGTGCGTTGCATACAATGACCCTCGTTTACTTTCCACAAAAGGTAAGAGTATGTCTGCT GCGGCATCTCCATTCGTGGTTGCCATTCAAAACTCAGGTATTGAAGTCTTACCTCATATC TTCAATGCTTGTGTCTTGGTTTTCGTTTTCAGTGCTTGTAACTCAGATTTGTACGTTTCT TCCAGAAATTTATATGCGTTGGCAATTGATGGTAAAGCGCCAAAGATCTTCGCTAAGACA AGTAGATGGGGTGTTCCTTACAATGCTTTAATACTCTCCGTGCTGTTTTGTGGCTTGGCG TACATGAATGTGTCTTCAGGATCAGCAAAGATTTTCAACTACTTTGTTAACGTTGTTTCT ATGTTCGGAATCTTGAGTTGGATCACCATTTTAATTGTTTACATCTACTTCGATAAAGCC TGCCGTGCTCAAGGGATTGACAAATCAAAATTTGCTTATGTCGCTCCTGGCCAACGTTAT GGTGCTTATTTTGCTTTATTCTTCTGCATTTTGATTGCTTTAATCAAAAACTTCACTGTT TTCCTAGGTCATAAATTTGATTATAAAACATTCATCACCGGGTATATTGGCCTGCCTGTC TATATCATTTCTTGGGCTGGTTACAAATTGATATACAAAACCAAAGTGATAAAGTCTACC GACGTGGATTTGTACACATTTAAGGAAATATACGATAGAGAAGAAGAAGAGGGAAGAATG AAGGACCAAGAAAAGGAAGAGCGTTTAAAAAGTAACGGTAAAAATATGGAGTGGTTCTAT GAAAAATTTTTGGGTAATATCTTCTAG
Protein Properties
Pfam Domain Function
Protein Residues608
Protein Molecular Weight68096.70313
Protein Theoretical pI9.17
Signalling Regions
  • None
Transmembrane Regions
  • 91-111
  • 120-142
  • 157-177
  • 202-222
  • 232-252
  • 286-306
  • 323-343
  • 373-393
  • 424-444
  • 455-475
  • 502-522
  • 531-551
Protein Sequence>Dicarboxylic amino acid permease MKMPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVSSRSSTS TSPSARDDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAM LIAYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPN QLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGL ILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGI ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSA AASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA CRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPV YIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY EKFLGNIF
References
External Links
ResourceLink
Saccharomyces Genome Database DIP5
Uniprot IDP53388
Uniprot NameDIP5_YEAST
GenBank Gene IDX95802
Genebank Protein ID1213234
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956