You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha-glucosidase MAL12
Synonyms
  • Maltase
Gene NameMAL12
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionHydrolysis of terminal, non-reducing (1->4)- linked alpha-D-glucose residues with release of alpha-D-glucose
Cellular LocationNot Available
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Galactose metabolismec00052 Map00052
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG Reactions
Maltose + waterD-Glucose
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00286D-GlucoseShow
YMDB00584MaltoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
ion binding
cation binding
catalytic activity
binding
Process
carbohydrate metabolic process
metabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR292W
Gene Sequence>1755 bp ATGACTATTTCTGATCATCCAGAAACAGAACCAAAGTGGTGGAAAGAGGCCACAATCTAT CAAATTTACCCAGCAAGTTTTAAAGACTCCAATAACGATGGCTGGGGTGATTTAAAAGGT ATCACTTCCAAGTTGCAGTATATTAAAGATCTTGGCGTTGATGCTATTTGGGTTTGTCCG TTTTATGACTCTCCTCAACAAGATATGGGGTATGATATATCCAACTACGAAAAGGTCTGG CCCACATATGGTACCAATGAGGACTGTTTTGAGCTAATTGACAAGACTCATAAGCTGGGT ATGAAATTCATCACCGATTTGGTTATCAACCACTGTTCTACAGAACACGAATGGTTCAAA GAGAGCAGATCCTCGAAGACCAATCCGAAGCGTGACTGGTTCTTCTGGAGACCTCCTAAG GGTTATGACGCCGAAGGCAAGCCAATTCCTCCAAACAATTGGAAATCTTTCTTTGGTGGT TCAGCTTGGACTTTTGATGAAACTACAAATGAATTTTACCTCCGTTTGTTTGCGAGTCGT CAAGTTGACTTGAATTGGGAGAATGAAGACTGCAGAAGGGCAATCTTTGAAAGTGCTGTT GGATTTTGGCTGGACCATGGTGTAGATGGTTTTAGAATCGATACCGCTGGTTTGTATTCG AAACGTCCTGGTTTACCAGATTCCCCAATTTTTGACAAAACCTCGAAATTACAACATCCA AATTGGGGGTCTCACAATGGTCCTAGGATTCATGAATATCATCAAGAACTACACAGATTT ATGAAAAACAGGGTGAAAGATGGTAGAGAAATAATGACAGTCGGTGAAGTTGCCCATGGA AGTGATAATGCTTTATACACCAGTGCAGCTAGATACGAAGTCAGCGAAGTTTTCTCCTTC ACGCACGTTGAAGTTGGTACCTCGCCATTTTTCCGTTATAACATAGTGCCCTTCACCTTG AAACAATGGAAAGAAGCCATTGCATCGAACTTTTTGTTCATTAACGGTACTGATAGTTGG GCTACCACCTACATCGAGAATCACGATCAAGCCCGGTCAATTACGAGATTTGCTGACGAT TCGCCAAAGTACCGTAAAATATCTGGTAAGCTGTTAACATTGCTAGAATGTTCATTGACA GGTACGTTGTATGTCTATCAAGGTCAGGAGATAGGCCAGATCAATTTCAAGGAATGGCCT ATTGAAAAGTATGAGGACGTTGATGTGAAAAACAACTACGAGATTATCAAAAAAAGTTTT GGTAAAAACTCGAAGGAAATGAAGGATTTTTTTAAAGGAATCGCCCTACTTTCTAGAGAT CATTCGAGAACTCCCATGCCATGGACGAAAGATAAGCCCAATGCTGGATTTACTGGCCCA GATGTTAAACCTTGGTTTCTCTTGAATGAATCTTTCGAGCAAGGAATCAATGTTGAGCAG GAATCCAGAGATGATGACTCAGTTCTCAATTTTTGGAAAAGGGCCTTGCAAGCCAGAAAG AAATATAAGGAACTTATGATTTATGGTTACGATTTCCAATTCATTGATTTAGACAGTGAC CAGATCTTTAGCTTCACTAAAGAGTACGAAGACAAGACGCTGTTTGCTGCTTTAAATTTC AGTGGCGAAGAAATTGAATTCAGCCTCCCAAGAGAAGGTGCTTCTTTATCTTTTATTCTT GGAAATTATGATGATACTGACGTTTCCTCCAGAGTTTTGAAACCATGGGAAGGTAGAATC TACCTCGTCAAATAA
Protein Properties
Pfam Domain Function
Protein Residues584
Protein Molecular Weight68093.70313
Protein Theoretical pI5.44
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alpha-glucosidase MAL12 MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF THVEVGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFLLNESFEQGINVEQ ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
References
External Links
ResourceLink
Saccharomyces Genome Database MAL12
Uniprot IDP53341
Uniprot NameMAL12_YEAST
GenBank Gene IDZ73077
Genebank Protein ID1323534
General Reference
  • Volckaert, G., Voet, M., Robben, J. (1997). "Sequence analysis of a near-subtelomeric 35.4 kb DNA segment on the right arm of chromosome VII from Saccharomyces cerevisiae carrying the MAL1 locus reveals 15 complete open reading frames, including ZUO1, BGL2 and BIO2 genes and an ABC transporter gene." Yeast 13:251-259.9090054
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106