Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUncharacterized protein YGR277C
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotidyltransferase activity
Specific FunctionNot Available
Cellular LocationNot Available
SMPDB Pathways
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
4'-phosphopantetheine + Adenosine triphosphate + hydronPyrophosphate + Dephospho-CoA
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00308Pantetheine 4'-phosphateShow
YMDB00357Dephospho-CoAShow
YMDB00862hydronShow
YMDB162644'-phosphopantetheineShow
GO Classification
Component
Not Available
Function
nucleotidyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
biosynthetic process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYGR277C
Gene Sequence>918 bp ATGGTTGAGGAAAATTCCAGAGTTTTGATTGTTCTTCCTTATACACCGCCTAGTGCTACT TTGCAGAGGATTATAGGGCAAACTATTCCGTTCTTAAGAGAATGTCAAAGTCAACTAGAC ATCGTGATTGTACCTGAATTCAAAACCTCATTCCAGTTGGATTCTGCGCTAGGGAAGATG TACAGTATTACCAGGGATGTCCTTTTGGGCTATGGAATGATCAACAGCGGAATCAACATC ATATTCAACAATATTCATTTCGTCGAGAGTAATTTGCAATGGAAAGTGGTTTTATTGCCA CAGGAATCCACTTTTGAAACTTGGAAGCTAGAGTTGGGACAAGGACAATACCATAGTATA GAACATTATGCATTACACGATAATATAATGGAAGAGATAGAAGGTCCCAAAGATGCTAAC AAATTTCATGTCACCGCATTGGGCGGAACGTTCGACCACATTCACGATGGACATAAAATA TTGTTGAGCGTCTCTACATTCATCACGTCACAAAGGTTAATTTGTGGAATTACGTGCGAT GAGCTCTTGCAAAACAAGAAATACAAAGAGTTGATTGAACCTTATGATACACGATGCAGG CACGTACATCAATTCATCAAGTTGTTAAAACCGGATCTCTCCGTAGAACTAGTTCCCTTA AGGGACGTGTGCGGCCCCACAGGGAAAGTACCCGAGATAGAATGTTTAGTTGTGAGTAGA GAAACCGTCAGTGGGGCAGAGACTGTGAATAAGACTAGGATTGAAAAAGGCATGAGCCCA TTGGCAGTACATGTGGTTAATGTACTTGGAGGAAGGGAGGAAGACGGCTGGAGCGAGAAG TTAAGCAGCACGGAAATCAGACGCCTACTTAAGTCCTCTGCTTCGCCAACGTGCACTCCA CAAAACCCTTGCGTATAA
Protein Properties
Pfam Domain Function
Protein Residues305
Protein Molecular Weight34306.30078
Protein Theoretical pI6.28
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uncharacterized protein YGR277C MVEENSRVLIVLPYTPPSATLQRIIGQTIPFLRECQSQLDIVIVPEFKTSFQLDSALGKM YSITRDVLLGYGMINSGINIIFNNIHFVESNLQWKVVLLPQESTFETWKLELGQGQYHSI EHYALHDNIMEEIEGPKDANKFHVTALGGTFDHIHDGHKILLSVSTFITSQRLICGITCD ELLQNKKYKELIEPYDTRCRHVHQFIKLLKPDLSVELVPLRDVCGPTGKVPEIECLVVSR ETVSGAETVNKTRIEKGMSPLAVHVVNVLGGREEDGWSEKLSSTEIRRLLKSSASPTCTP QNPCV
References
External Links
ResourceLink
Saccharomyces Genome Database YGR277C
Uniprot IDP53332
Uniprot NameYG5T_YEAST
GenBank Gene IDAY692609
Genebank Protein ID51012669
General Reference
  • Volckaert, G., Voet, M., Robben, J. (1997). "Sequence analysis of a near-subtelomeric 35.4 kb DNA segment on the right arm of chromosome VII from Saccharomyces cerevisiae carrying the MAL1 locus reveals 15 complete open reading frames, including ZUO1, BGL2 and BIO2 genes and an ABC transporter gene." Yeast 13:251-259.9090054
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ruzzi, M., Marconi, A., Saliola, M., Fabiani, L., Montebove, F., Frontali, L. (1997). "The sequence of a 8 kb segment on the right arm of yeast chromosome VII identifies four new open reading frames and the genes for yTAFII145." Yeast 13:365-368.9133740
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106