You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphogluconolactonase 4
Synonyms
  • 6PGL
Gene NameSOL4
Enzyme Class
Biological Properties
General FunctionInvolved in 6-phosphogluconolactonase activity
Specific FunctionHydrolysis of 6-phosphogluconolactone to 6- phosphogluconate
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
SMPDB ReactionsNot Available
KEGG Reactions
water + 6-Phosphonoglucono-D-lactone6-Phosphogluconic acid + hydron
Metabolites
YMDB IDNameView
YMDB001406-Phosphonoglucono-D-lactoneShow
YMDB002186-Phosphogluconic acidShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
6-phosphogluconolactonase activity
hydrolase activity
hydrolase activity, acting on ester bonds
catalytic activity
carboxylesterase activity
Process
pentose-phosphate shunt
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
metabolic process
glucose metabolic process
glucose catabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR248W
Gene Sequence>768 bp ATGGTGAAATTACAAAGGTTTAGCGAAAAGAAAAGCCTCATACACGAATTCGGCAAGTTT ATCCTTGAAAAGCAAGAATCGGCGTTAACGGGCGACGCTGATGCAGTGTTCAATATCGCC ATCAGTGGAGGATCGATGAACCAAGCGCTGTACGAAAGTTTGGTAAATGACAAAAACATT TTTCCACATATTAAGTGGCCACAATGGAGAATCTTCTTCTGTGACGAAAGATTGGTTCCA TTTGAGGATCCGCAAAGTAACTATGGTCAGTTCAAAAAAACAGTTTTGGACCCGCTAGTG CATCAGGGCAACCAATTGAACTTAGGCCCCACTGTATACACTATCAACGAATCATTAATC GGTGGCGGTGAAACGGCCAATAGAAAGATTGCCGAAGAATACGCTTCCATGCTGCCTGCA TCATTCGACCTAATCTTACTCGGATGCGGAGAAGATGGACATACATGCTCGTTGTTTCCC GGGGTTGAATTTAATTACCTTGTAGAAGAGATGGACCGCAAGGTTTTATGGTGTAATAAT TCGCCCAAGGCACCCAAGGACAGGATCACCTTTACATTAGCAGTAGTAGCCGAGGCTAAA AGTGTGTGCTTTCTCGTTAGGGGAGCTGCTAAAAAGGCTATCATGCATGACGTGTTAATC GTAAAAAATAGCGAACTACCTAGTGTGCTGGTTAATGAAATGGTCGGAACCAAAGTAACT TGGTTTCTCGACGACGAAGCTGGCGCCTTGATTCCTGAAAACTGCTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues255
Protein Molecular Weight28447.5
Protein Theoretical pI5.01
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphogluconolactonase 4 MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQALYESLVNDKNI FPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLVHQGNQLNLGPTVYTINESLI GGGETANRKIAEEYASMLPASFDLILLGCGEDGHTCSLFPGVEFNYLVEEMDRKVLWCNN SPKAPKDRITFTLAVVAEAKSVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVT WFLDDEAGALIPENC
References
External Links
ResourceLink
Saccharomyces Genome Database SOL4
Uniprot IDP53315
Uniprot NameSOL4_YEAST
GenBank Gene IDZ73033
Genebank Protein ID1323450
General Reference
  • Feroli, F., Carignani, G., Pavanello, A., Guerreiro, P., Azevedo, D., Rodrigues-Pousada, C., Melchioretto, P., Panzeri, L., Agostoni Carbone, M. L. (1997). "Analysis of a 17.9 kb region from Saccharomyces cerevisiae chromosome VII reveals the presence of eight open reading frames, including BRF1 (TFIIIB70) and GCN5 genes." Yeast 13:373-377.9133742
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Stanford, D. R., Whitney, M. L., Hurto, R. L., Eisaman, D. M., Shen, W. C., Hopper, A. K. (2004). "Division of labor among the yeast Sol proteins implicated in tRNA nuclear export and carbohydrate metabolism." Genetics 168:117-127.15454531