You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSuccinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
Synonyms
  • Succinyl-CoA synthetase beta chain
  • SCS-beta
Gene NameLSC2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionATP + succinate + CoA = ADP + phosphate + succinyl-CoA
Cellular LocationMitochondrion
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Propanoate metabolismec00640 Map00640
SMPDB Reactions
Succinyl-CoA + phosphate + Guanosine diphosphateSuccinic acid + Coenzyme A + GTP
Adenosine triphosphate + itaconic acid + Coenzyme AADP + phosphate + itaconyl-CoA
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00109Adenosine triphosphateShow
YMDB00257Guanosine diphosphateShow
YMDB00338Succinic acidShow
YMDB00514Succinyl-CoAShow
YMDB00558GTPShow
YMDB00716itaconic acidShow
YMDB00717itaconyl-CoAShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
catalytic activity
binding
nucleoside binding
purine nucleoside binding
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR244C
Gene Sequence>1284 bp ATGTACTCAAGAAAATCCTTATCCCTAATTTCAAAGTGTGGGCAATTAAGCAGGCTAAAC GCGCAAGCTGCTTTACAAGCAAGGAGACACTTGTCAATTCATGAATACAGGTCAGCTCAG TTATTGAGGGAATACGGTATTGGTACTCCAGAAGGATTTCCAGCGTTCACTCCCGAAGAG GCTTTCGAAGCAGCCAAGAAATTAAACACTAACAAACTGGTCATCAAGGCGCAGGCATTG ACCGGAGGTAGAGGTAAAGGTCACTTCGACACCGGTTACAAAAGCGGTGTTCACATGATC GAAAGTCCTCAGCAGGCAGAGGATGTTGCAAAAGAAATGCTCAATCATAACCTGATTACT AAACAGACGGGAATAGCGGGGAAGCCAGTATCTGCTGTATATATAGTGAAAAGAGTAGAT ACAAAGCATGAAGCTTATTTATCTATTCTAATGGACAGACAAACCAAGAAACCGATGATC ATTGCGTCCAGTCAAGGTGGTATGAATATTGAAGAGGTGGCTGAGAGAACCCCAGATGCT ATAAAGAAATTTTCAATTGAAACTTCAAAGGGATTGAGCCCACAAATGGCCAAGGATGTT GCCAAGAGTCTCGGTTTCAGTCCCGATGCACAAGACGAGGCAGCAAAAGCTGTTTCCAAT TTGTATAAAATATTCATGGAAAGGGATGCTACACAAGTGGAGATTAACCCTTTGAGTGAA ATTGAACATGATCCAACCCACAAAATCATGTGTACAGACGCCAAATTTGGGTTTGATGAT AACGCATCATTCAGACAGGAAAAGATATATTCCTGGAGGGACTTATCACAAGAAGATCCT GATGAAGTTAAGGCAAAGAAGTATGATTTGAATTTTGTTAAGTTGAAGGGTAACATTGGA TGTTTAGTCAATGGTGCTGGTTTGGCTATGGCTACTATGGATGTCATCAAATTAAATGGA GGCGATCCTGCGAACTTTTTGGATTGTGGTGGTGGTGCCACCCCTGAGACCATCAAACAA GGTTTCGAATTGATCTTATCCAATAAGAACGTAGATGCAATTTTCGTCAATATTTTCGGC GGTATCGTAAGATGTGACTATGTTGCCCTGGGGCTGGTAGAAGCCGCCAGAGAACTAGAA GTTAGGGTCCCCATTGTGGCACGTTTGCAAGGTACCAAAGTAGAAGAAGGCCGCGACATT ATCAATAAGTCAGGCGTGAAGATTTATTCGTTTGATGAATTAGATCCTGCTGCTAAAAAG GTCGTTGAATTGACCCAAAATTAA
Protein Properties
Pfam Domain Function
Protein Residues427
Protein Molecular Weight46900.30078
Protein Theoretical pI7.56
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial MYSRKSLSLISKCGQLSRLNAQAALQARRHLSIHEYRSAQLLREYGIGTPEGFPAFTPEE AFEAAKKLNTNKLVIKAQALTGGRGKGHFDTGYKSGVHMIESPQQAEDVAKEMLNHNLIT KQTGIAGKPVSAVYIVKRVDTKHEAYLSILMDRQTKKPMIIASSQGGMNIEEVAERTPDA IKKFSIETSKGLSPQMAKDVAKSLGFSPDAQDEAAKAVSNLYKIFMERDATQVEINPLSE IEHDPTHKIMCTDAKFGFDDNASFRQEKIYSWRDLSQEDPDEVKAKKYDLNFVKLKGNIG CLVNGAGLAMATMDVIKLNGGDPANFLDCGGGATPETIKQGFELILSNKNVDAIFVNIFG GIVRCDYVALGLVEAARELEVRVPIVARLQGTKVEEGRDIINKSGVKIYSFDELDPAAKK VVELTQN
References
External Links
ResourceLink
Saccharomyces Genome Database LSC2
Uniprot IDP53312
Uniprot NameSUCB_YEAST
GenBank Gene IDZ73029
Genebank Protein ID1323442
General Reference
  • Guerreiro, P., Azevedo, D., Barreiros, T., Rodrigues-Pousada, C. (1997). "Sequencing of a 9.9 kb segment on the right arm of yeast chromosome VII reveals four open reading frames, including PFK1, the gene coding for succinyl-CoA synthetase (beta-chain) and two ORFs sharing homology with ORFs of the yeast chromosome VIII." Yeast 13:275-280.9090057
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Przybyla-Zawislak, B., Dennis, R. A., Zakharkin, S. O., McCammon, M. T. (1998). "Genes of succinyl-CoA ligase from Saccharomyces cerevisiae." Eur J Biochem 258:736-743.9874242
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956