You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1
SynonymsNot Available
Gene NameGPI1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphatidylinositol N-acetylglucosaminyltransferase activity
Specific FunctionPart of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG Pathways
Glycosylphosphatidylinositol(GPI)-anchor biosynthesisec00563 Map00563
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00307Uridine 5'-diphosphateShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
UDP-glycosyltransferase activity
acetylglucosaminyltransferase activity
phosphatidylinositol N-acetylglucosaminyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Process
protein amino acid lipidation
GPI anchor biosynthetic process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR216C
Gene Sequence>1830 bp ATGCCAAATTACATTTTCTGGCCATACGAATCCTTGTTCGAGAATTCCGCAGCTCAAGGA CCTCAGGTAGCTTTGGCAATTTCATTTGAGAAGACGCATTTTGTTGTCTTAGGTGTTTGC GAACCTCAGTATTTAGAAGAAGTAAGCATACGGCCCCCTTATTCAGTGGTAGCTACTAAG AACAATGGAGCGGAGGGTTGGAACTACAAAGTTGCTGATCCCTGTAATGTCCATTTTAGA ATACCCAAGCTGAAATTTATGCAATTCTATTCTTCTGATCCCATCTCGCTCATCATACCA GAAAAAGAAGTTGGTCTTCATAGTAGTGTGGGTGAAACTCTGAACTATTCTAAATTAGAG CAACATCCAAGATACAAGAGAGATAATAAGAAATTGAGTGAAACTTTGAACATCATTAAT CTATTCCCCGCATATTGTAAAGCATTAAATGAGCTTTACCCGTTTATTCAAACATCACAG GAAAATTTGAGGGGTACTATGCTTAATAGTGTCGCAGCTTGGTGTTCATCTACTTGTATT TATAAAATGGTCGCAAAAATTGGTTTTTATTTGACTTTTGTGATCTGCTCTATTGCTAGT CTCGTATCCTCGTTATTAAATTATTCGCACTTTCAGTTGGTAAATTACTCGGCATTTGTC CAGCAAATCGATCTTCGTTGTCAACAAATTTGCTATTTCCCAGTACAGTATGAGCGTATT AATAAGAAGGATAACATACAGAATGTTGGCTCTATGGTGGAAAAAGATAATTCTAATAGT CAATTCTCACATTCATATATGCCTTCTAAATTCTATCCCGATTATATTTTATTGTATAAT ACAATTTGGCTTATTATTAATGACATTTCATTTGGTTTAATATTGGGGGCCATACTTATT GAGAATCGAGATTTCTTGGTGTCGGCATCCCATAGAGTATTGAAGTTTTTTTTATATGAT TCATTAAAAACAATAACTGAAACGTTAGCAAATAACCCCCTTGGCATCAAATTAAATGCA GAACTTGCGAACTTTTTGAGCGAATTATTTCTTTGGGTGATAGAATTTTCTTATACCACA TTCATAAAAAGACTCATTGATCCGAAAACCCTATCATCTTTGCTCACGTTAACGATATAT ATGATGTTTCTCGTTGGCTTTTCTTTTGCTGTTTCCCTAGCGATTGATTTTTTTGCAATT TTAAGTTTTCCAATATATGTTTTTTATCGTATCAGCAGTAAACTGTACCATTGTCAGTTG AATATTATGGCTAGTCTTTTTAACCTGTTCTGCGGTAAAAAGAGGAACGTTTTACGAAAT AGGATTGACCATAACTATTTTCAACTAGATCAATTGCTATTGGGAACATTATTATTTATT ATTCTAGTGTTCTTGACTCCCACAGTGATGGCATTCTATATGTCATACACAGTTTTGAGA ATGCTAACAATAACTATCGAAATATTCTCGGAAGCTGTCATTGCACTCATTAACCATTTT CCATTGTTCGCATTATTACTTAGGTTAAAAGATCCTAAACGTCTACCCGGTGGCATTTCA ATTGAGCTCAAAACCACGGTTTCTAACAAGCATACAACCTTAGAACTTCAAAACAATCCT ATTAAATTCAAGAGTATGTTCAGACCATACAATCTATTGTTGTCGCAAATGAGGACAAAT TATTTCTCGTTTGCTACTGTACGAAAGATTGTCCGAGGGGAGTCTATAATGGTCAATAGA AATAAGCTGTACTATGTTCTTTATTCTTCACTGCCTAGTAAGCCATTGAGTGTAAAGGAT TTATACAAAAGGCTGACTATTCAGGCATAA
Protein Properties
Pfam Domain Function
Protein Residues609
Protein Molecular Weight70353.70313
Protein Theoretical pI9.4
Signalling Regions
  • None
Transmembrane Regions
  • 187-207
  • 281-301
  • 381-401
  • 452-472
  • 486-506
Protein Sequence>Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 MPNYIFWPYESLFENSAAQGPQVALAISFEKTHFVVLGVCEPQYLEEVSIRPPYSVVATK NNGAEGWNYKVADPCNVHFRIPKLKFMQFYSSDPISLIIPEKEVGLHSSVGETLNYSKLE QHPRYKRDNKKLSETLNIINLFPAYCKALNELYPFIQTSQENLRGTMLNSVAAWCSSTCI YKMVAKIGFYLTFVICSIASLVSSLLNYSHFQLVNYSAFVQQIDLRCQQICYFPVQYERI NKKDNIQNVGSMVEKDNSNSQFSHSYMPSKFYPDYILLYNTIWLIINDISFGLILGAILI ENRDFLVSASHRVLKFFLYDSLKTITETLANNPLGIKLNAELANFLSELFLWVIEFSYTT FIKRLIDPKTLSSLLTLTIYMMFLVGFSFAVSLAIDFFAILSFPIYVFYRISSKLYHCQL NIMASLFNLFCGKKRNVLRNRIDHNYFQLDQLLLGTLLFIILVFLTPTVMAFYMSYTVLR MLTITIEIFSEAVIALINHFPLFALLLRLKDPKRLPGGISIELKTTVSNKHTTLELQNNP IKFKSMFRPYNLLLSQMRTNYFSFATVRKIVRGESIMVNRNKLYYVLYSSLPSKPLSVKD LYKRLTIQA
References
External Links
ResourceLink
Saccharomyces Genome Database GPI1
Uniprot IDP53306
Uniprot NameGPI1_YEAST
GenBank Gene IDU66864
Genebank Protein ID1620666
General Reference
  • Leidich, S. D., Orlean, P. (1996). "Gpi1, a Saccharomyces cerevisiae protein that participates in the first step in glycosylphosphatidylinositol anchor synthesis." J Biol Chem 271:27829-27837.8910381
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Sobering, A. K., Watanabe, R., Romeo, M. J., Yan, B. C., Specht, C. A., Orlean, P., Riezman, H., Levin, D. E. (2004). "Yeast Ras regulates the complex that catalyzes the first step in GPI-anchor biosynthesis at the ER." Cell 117:637-648.15163411
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258