You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlcohol O-acetyltransferase 2
Synonyms
  • AATase 2
Gene NameATF2
Enzyme Class
Biological Properties
General FunctionInvolved in alcohol O-acetyltransferase activity
Specific FunctionAcetyl-CoA + an alcohol = CoA + an acetyl ester
Cellular LocationMembrane; Peripheral membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Acetyl-CoA + 2-methylbutan-1-ol2-Methylbutyl acetate + Coenzyme A
Ethanol + Acetyl-CoAEthyl acetate + Coenzyme A
Acetyl-CoA + isoamylolisoamyl acetate + Coenzyme A
Acetyl-CoA + isobutanolisobutyl acetate + Coenzyme A
Acetyl-CoA + 2-phenylethanolphenethyl acetate + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
YMDB005672-methylbutan-1-olShow
YMDB005682-Methylbutyl acetateShow
YMDB00569Ethyl acetateShow
YMDB00570isoamylolShow
YMDB00571isoamyl acetateShow
YMDB00572isobutyl acetateShow
YMDB00573isobutanolShow
YMDB00574phenethyl acetateShow
YMDB00790Isopentyl acetateShow
YMDB00798IsopentanolShow
YMDB00883EthanolShow
YMDB014701-PentanolShow
YMDB01471Pentyl acetateShow
YMDB01472Phenylethyl acetateShow
YMDB014731-HexanolShow
YMDB014751-HeptanolShow
YMDB01476Heptyl acetateShow
YMDB01477Octyl acetateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
O-acyltransferase activity
O-acetyltransferase activity
alcohol O-acetyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring acyl groups
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR177C
Gene Sequence>1608 bp ATGGAAGATATAGAAGGATACGAACCACATATCACTCAAGAGTTGATAGACCGTGGCCAT GCAAGACGTATGGGCCACTTGGAAAACTACTTTGCTGTTTTGAGTAGGCAGAAAATGTAC TCGAATTTTACTGTTTACGCGGAATTGAATAAAGGTGTTAATAAGAGACAACTAATGCTT GTCTTGAAAGTATTACTTCAAAAATACTCAACTCTTGCGCATACAATCATTCCTAAGCAT TATCCTCATCATGAAGCGTACTACTCTAGCGAAGAGTACCTTAGTAAACCTTTTCCACAG CATGATTTCATAAAGGTGATTTCTCATCTTGAATTCGATGACTTGATTATGAATAATCAA CCAGAATACAGAGAAGTCATGGAGAAAATCTCAGAACAGTTCAAAAAGGATGATTTCAAA GTCACCAATAGGTTAATCGAATTGATTAGCCCTGTAATCATACCTCTGGGTAATCCGAAG AGGCCTAATTGGAGATTGATTTGTTTACCAGGTAAGGATACTGATGGGTTTGAAACGTGG AAAAACTTCGTTTATGTCACTAACCACTGCGGCTCCGACGGTGTCAGTGGATCGAATTTT TTCAAAGATTTAGCTCTACTCTTTTGTAAAATCGAAGAAAAAGGGTTTGATTATGATGAA GAGTTCATCGAAGATCAAGTCATCATTGACTATGATCGAGACTACACTGAAATTTCTAAA TTGCCAAAACCGATTACGGATCGTATTGACTACAAGCCAGCATTGACTTCATTACCCAAA TTCTTTTTAACAACCTTCATTTATGAACATTGTAATTTTAAAACCTCCAGCGAATCTACA CTTACAGCTAGATATAGCCCCTCTAGTAATGCTAATGCTAGTTACAATTACTTGTTGCAT TTCAGTACTAAGCAAGTAGAACAAATCAGAGCTCAGATCAAGAAAAATGTTCACGATGGG TGCACCCTAACACCCTTCATTCAAGCGTGCTTTCTTGTAGCCCTGTATAGACTGGATAAG CTGTTCACAAAATCTCTTCTCGAGTATGGGTTCGATGTGGCTATTCCAAGCAACGCAAGA AGGTTTTTACCAAACGATGAAGAGTTAAGAGATTCTTATAAATACGGCTCCAACGTTGGA GGTTCGCATTACGCCTATCTAATCTCCTCATTCGACATTCCCGAAGGTGACAATGACAAG TTTTGGAGTCTTGTCGAATACTACTATGACCGCTTTTTAGAATCGTACGACAACGGTGAC CACTTGATTGGTCTGGGGGTCCTACAACTTGATTTTATCGTTGAAAACAAGAATATAGAC AGCCTTCTTGCCAACTCTTATTTGCACCAGCAAAGAGGCGGTGCAATCATCAGTAATACA GGACTTGTCTCGCAAGATACGACCAAGCCGTACTACGTTCGGGATTTAATCTTCTCGCAG TCTGCAGGCGCCTTGAGATTTGCGTTCGGCCTAAACGTTTGCTCCACAAACGTGAATGGT ATGAACATGGACATGAGCGTGGTTCAGGGCACTCTACGGGATCGTGGCGAATGGGAATCG TTCTGCAAGCTCTTCTACCAAACCATCGGCGAATTTGCGTCGCTTTAA
Protein Properties
Pfam Domain Function
Protein Residues535
Protein Molecular Weight61897.5
Protein Theoretical pI5.73
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alcohol O-acetyltransferase 2 MEDIEGYEPHITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLML VLKVLLQKYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQ PEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW KNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISK LPKPITDRIDYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLH FSTKQVEQIRAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNAR RFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGD HLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTKPYYVRDLIFSQ SAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTIGEFASL
References
External Links
ResourceLink
Saccharomyces Genome Database ATF2
Uniprot IDP53296
Uniprot NameATF2_YEAST
GenBank Gene IDZ72961
Genebank Protein ID1323313
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956