Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutamyl-tRNA(Gln) amidotransferase subunit F, mitochondrial
Synonyms
  • Glu-ADT subunit F
  • gatF
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionFurnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu- tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho- Glu-tRNA(Gln)
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO ClassificationNot Available
Gene Properties
Chromosome LocationNot Available
LocusYGR102C
Gene Sequence>552 bp ATGTACAAAACATGGCGTCTATGCGGAACACATACAGTGGGTGGGTTATGCCATGATGGA AGTCATCGGTTCGTATCTACGGGAGGGGCAAAGATTGGTAAAAAATTTGAAAATATGAAT CAAATAAGGGATTATTTATCAAGACCTGTATGGTCCGTCCACGAATATTTAGGCATAAAC ACTAAAGAGGAAAAACTAGAGCCACCGTCTGCTGAAGCTGTAAAAAAATTGTTGCGGTTA TCAGGTCTTCCCTTGGAAGGAGCAGATATTAAAGAAATTCAAATGCGACTTGCCAAGCAA TTATCATTCATCAACAAACTCCATAACATACCTGTCGAAGGTGAAAAGCACACCAAGGAA TATGATGCTCGGTTGGTGCAAAGAAATACGAAACAGCTGAACTACACAAAGCTACTTGAA GGCATCAGCCACCAAAAGCAGGATGCTGAGCTAGGAGAAGTTAGCGGATCTTGGAAAGCA ACTGGACTTGCCGCGGAATCCAAAAATGCATATTTTGTTGTCAAAGAGGGACTACTCAAA AACAGGAAGTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues183
Protein Molecular Weight20786.80078
Protein Theoretical pI10.15
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutamyl-tRNA(Gln) amidotransferase subunit F, mitochondrial MYKTWRLCRTHTVGGLCHDGSHRFVSTGGAKIGKKFENMNQIRDYLSRPVWSVHEYLGIN TKEEKLEPPSAEAVKKLLRLSGLPLEGADIKEIQMRLAKQLSFINKLHNIPVEGEKHTKE YDARLVQRNTKQLNYTKLLEGISHQKQDAELGEVSGSWKATGLAAESKNAYFVVKEGLLK NRK
References
External Links
ResourceLink
Saccharomyces Genome Database YGR102C
Uniprot IDP53260
Uniprot NameGATF_YEAST
GenBank Gene IDAY558325
Genebank Protein ID45270540
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961
  • Frechin, M., Senger, B., Braye, M., Kern, D., Martin, R. P., Becker, H. D. (2009). "Yeast mitochondrial Gln-tRNA(Gln) is generated by a GatFAB-mediated transamidation pathway involving Arc1p-controlled subcellular sorting of cytosolic GluRS." Genes Dev 23:1119-1130.19417106