You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial thiamine pyrophosphate carrier 1
SynonymsNot Available
Gene NameTPC1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionMitochondrial transporter that mediates uptake of thiamine pyrophosphate (ThPP) into mitochondria
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00381Thiamine pyrophosphateShow
GO Classification
Component
cell part
membrane
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome LocationNot Available
LocusYGR096W
Gene Sequence>945 bp ATGTTCAAAGAGGAGGACTCGTTAAGAAAAGGGCAAAATGTGGCCGCGTGGAAAACTTTG TTGGCTGGCGCCGTATCCGGGCTGCTTGCCCGTAGCATAACTGCTCCCATGGATACCATT AAGATCAGATTGCAATTGACCCCTGCAAATGGGCTGAAGCCCTTCGGAAGTCAGGTCATG GAGGTGGCCAGAAGCACGATAAAGAACGAAGGCATCCGGTCCTTTTGGAAGGGTAACATA CCCGGTTCTTTGCTGTACGTTACCTATGGCTCAGCGCAGTTTAGTTCATACTCCCTTTTT AATAGATATTTAACTCCATTTGGACTAGAGGCGCGCTTACATAGTCTTGTTGTCGGAGCC TTTGCTGGCATAACCAGTTCCATCGTTTCCTACCCGTTCGATGTTTTACGGACCCGACTA GTTGCCAACAACCAGATGCACTCAATGAGCATCACGAGAGAAGTGCGTGATATCTGGAAA CTAGAAGGTCTCCCCGGATTTTTCAAGGGCTCCATCGCGTCAATGACAACCATAACTCTA ACCGCATCTATAATGTTCGGAACATACGAAACAATCAGGATATACTGTGACGAAAACGAA AAAACGACCGCCGCGCATAAAAAATGGGAACTGGCTACTTTAAATCACAGCGCTGGTACC ATTGGCGGCGTCATTGCTAAGATCATTACTTTCCCCCTCGAAACGATCCGTAGGCGAATG CAGTTCATGAATTCGAAGCATCTGGAAAAGTTCTCCCGTCATTCGTCTGTATACGGTTCT TATAAAGGGTACGGATTCGCAAGAATCGGTTTACAGATTTTGAAACAAGAAGGTGTGAGT TCGCTTTACAGAGGTATTCTGGTGGCCCTTTCCAAGACAATACCCACCACTTTTGTGAGT TTCTGGGGGTATGAAACTGCCATCCATTATTTGCGGATGTACTAA
Protein Properties
Pfam Domain Function
Protein Residues314
Protein Molecular Weight35136.5
Protein Theoretical pI10.43
Signalling Regions
  • None
Transmembrane Regions
  • 14-30
  • 84-100
  • 116-136
  • 170-186
  • 217-233
  • 285-302
Protein Sequence>Mitochondrial thiamine pyrophosphate carrier 1 MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGA FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL TASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS FWGYETAIHYLRMY
References
External Links
ResourceLink
Saccharomyces Genome Database TPC1
Uniprot IDP53257
Uniprot NameTPC1_YEAST
GenBank Gene IDAY693109
Genebank Protein ID51013669
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • el Moualij, B., Duyckaerts, C., Lamotte-Brasseur, J., Sluse, F. E. (1997). "Phylogenetic classification of the mitochondrial carrier family of Saccharomyces cerevisiae." Yeast 13:573-581.9178508
  • Belenkiy, R., Haefele, A., Eisen, M. B., Wohlrab, H. (2000). "The yeast mitochondrial transport proteins: new sequences and consensus residues, lack of direct relation between consensus residues and transmembrane helices, expression patterns of the transport protein genes, and protein-protein interactions with other proteins." Biochim Biophys Acta 1467:207-218.10930523
  • Marobbio, C. M., Vozza, A., Harding, M., Bisaccia, F., Palmieri, F., Walker, J. E. (2002). "Identification and reconstitution of the yeast mitochondrial transporter for thiamine pyrophosphate." EMBO J 21:5653-5661.12411483
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095