Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidate cytidylyltransferase, mitochondrial
Synonyms
  • CDP-diacylglycerol synthase
  • Mitochondrial import protein MMP37
  • Mitochondrial matrix protein of 37 kDa
  • Mitochondrial translocator assembly and maintenance protein 41
  • CDP-DAG synthase
Gene NameTAM41
Enzyme ClassNot Available
Biological Properties
General FunctionCDP-diacylglycerol biosynthetic process
Specific FunctionCatalyzes the formation of CDP-diacylglycerol (CDP-DAG) from phosphatidic acid (PA) in the mitochondrial inner membrane. Required for the biosynthesis of the dimeric phospholipid cardiolipin, which stabilizes supercomplexes of the mitochondrial respiratory chain in the mitochondrial inner membrane.
Cellular LocationNot Available
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
PA(16:0/16:0) + hydron + Cytidine triphosphatePyrophosphate + CDP-DG(16:0/16:0)
DG(16:0/16:0/0:0) + hydron + Cytidine triphosphateCDP-DG(16:0/16:0) + Pyrophosphate
PA(16:0/16:0) + hydron + Cytidine triphosphate Pyrophosphate + CDP-DG(16:0/16:0)
PA(16:0/16:0) + hydron + Cytidine triphosphatePyrophosphate + CDP-DG(14:0/14:0)
PA(14:0/14:0) + hydron + Cytidine triphosphatePyrophosphate + CDP-DG(14:0/14:0)
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB00279Cytidine triphosphateShow
YMDB00862hydronShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB12067CDP-DG(10:0/10:0)Show
YMDB12068CDP-DG(10:0/12:0)Show
YMDB12069CDP-DG(10:0/14:0)Show
YMDB12070CDP-DG(10:0/14:1(11Z))Show
YMDB12071CDP-DG(10:0/14:1(9Z))Show
YMDB12072CDP-DG(10:0/15:0)Show
YMDB12073CDP-DG(10:0/15:1(11Z))Show
YMDB12074CDP-DG(10:0/15:1(9Z))Show
YMDB12075CDP-DG(10:0/16:0)Show
YMDB12076CDP-DG(10:0/16:1(11Z))Show
YMDB12077CDP-DG(10:0/16:1(9Z))Show
YMDB12078CDP-DG(10:0/18:0)Show
YMDB12079CDP-DG(10:0/18:1(11Z))Show
YMDB12080CDP-DG(10:0/18:1(9Z))Show
YMDB12081CDP-DG(10:0/20:0)Show
YMDB12082CDP-DG(10:0/20:1(11Z))Show
YMDB12083CDP-DG(10:0/20:1(13Z))Show
YMDB12084CDP-DG(10:0/22:0)Show
YMDB12086CDP-DG(10:0/22:1(9Z))Show
YMDB12087CDP-DG(10:0/23:1(11Z))Show
YMDB12088CDP-DG(10:0/23:1(9Z))Show
YMDB12089CDP-DG(10:0/24:0)Show
YMDB12090CDP-DG(10:0/24:1(11Z))Show
YMDB12091CDP-DG(10:0/24:1(9Z))Show
YMDB12092CDP-DG(10:0/25:0)Show
YMDB12093CDP-DG(10:0/25:1(11Z))Show
YMDB12094CDP-DG(10:0/25:1(9Z))Show
YMDB12095CDP-DG(10:0/26:0)Show
YMDB12096CDP-DG(10:0/26:1(11Z))Show
YMDB12097CDP-DG(10:0/26:1(9Z))Show
YMDB12100CDP-DG(12:0/12:0)Show
YMDB12101CDP-DG(12:0/14:0)Show
YMDB12102CDP-DG(12:0/14:1(11Z))Show
YMDB12103CDP-DG(12:0/14:1(9Z))Show
YMDB12104CDP-DG(12:0/15:0)Show
YMDB12105CDP-DG(12:0/15:1(11Z))Show
YMDB12106CDP-DG(12:0/15:1(9Z))Show
YMDB12107CDP-DG(12:0/16:0)Show
YMDB12108CDP-DG(12:0/16:1(11Z))Show
YMDB12109CDP-DG(12:0/16:1(9Z))Show
YMDB12110CDP-DG(12:0/18:0)Show
YMDB12111CDP-DG(12:0/18:1(11Z))Show
YMDB12112CDP-DG(12:0/18:1(9Z))Show
YMDB12113CDP-DG(12:0/20:0)Show
YMDB12114CDP-DG(12:0/20:1(11Z))Show
YMDB12115CDP-DG(12:0/20:1(13Z))Show
YMDB12116CDP-DG(12:0/22:0)Show
YMDB12118CDP-DG(12:0/22:1(9Z))Show
YMDB12119CDP-DG(12:0/23:1(11Z))Show
YMDB12120CDP-DG(12:0/23:1(9Z))Show
YMDB12121CDP-DG(12:0/24:0)Show
YMDB12122CDP-DG(12:0/24:1(11Z))Show
YMDB12123CDP-DG(12:0/24:1(9Z))Show
YMDB12131CDP-DG(14:0/14:0)Show
YMDB12132CDP-DG(14:0/14:1(11Z))Show
YMDB12133CDP-DG(14:0/14:1(9Z))Show
YMDB12134CDP-DG(14:0/15:0)Show
YMDB12135CDP-DG(14:0/15:1(11Z))Show
YMDB12136CDP-DG(14:0/15:1(9Z))Show
YMDB12137CDP-DG(14:0/16:0)Show
YMDB12138CDP-DG(14:0/16:1(11Z))Show
YMDB12139CDP-DG(14:0/16:1(9Z))Show
YMDB12140CDP-DG(14:0/18:0)Show
YMDB12141CDP-DG(14:0/18:1(11Z))Show
YMDB12142CDP-DG(14:0/18:1(9Z))Show
YMDB12143CDP-DG(14:0/20:0)Show
YMDB12144CDP-DG(14:0/20:1(11Z))Show
YMDB12145CDP-DG(14:0/20:1(13Z))Show
YMDB12146CDP-DG(14:0/22:0)Show
YMDB12148CDP-DG(14:0/22:1(9Z))Show
YMDB12159CDP-DG(14:1(11Z)/14:1(11Z))Show
YMDB12160CDP-DG(14:1(11Z)/14:1(9Z))Show
YMDB12161CDP-DG(14:1(11Z)/15:0)Show
YMDB12162CDP-DG(14:1(11Z)/15:1(11Z))Show
YMDB12163CDP-DG(14:1(11Z)/15:1(9Z))Show
YMDB12164CDP-DG(14:1(11Z)/16:0)Show
YMDB12165CDP-DG(14:1(11Z)/16:1(11Z))Show
YMDB12166CDP-DG(14:1(11Z)/16:1(9Z))Show
YMDB12167CDP-DG(14:1(11Z)/18:0)Show
YMDB12168CDP-DG(14:1(11Z)/18:1(11Z))Show
YMDB12169CDP-DG(14:1(11Z)/18:1(9Z))Show
YMDB12170CDP-DG(14:1(11Z)/20:0)Show
YMDB12171CDP-DG(14:1(11Z)/20:1(11Z))Show
YMDB12172CDP-DG(14:1(11Z)/20:1(13Z))Show
YMDB12173CDP-DG(14:1(11Z)/22:0)Show
YMDB12175CDP-DG(14:1(11Z)/22:1(9Z))Show
YMDB12186CDP-DG(14:1(9Z)/14:1(11Z))Show
YMDB12187CDP-DG(14:1(9Z)/14:1(9Z))Show
YMDB12188CDP-DG(14:1(9Z)/15:0)Show
YMDB12189CDP-DG(14:1(9Z)/15:1(11Z))Show
YMDB12190CDP-DG(14:1(9Z)/15:1(9Z))Show
YMDB12191CDP-DG(14:1(9Z)/16:0)Show
YMDB12192CDP-DG(14:1(9Z)/16:1(11Z))Show
YMDB12193CDP-DG(14:1(9Z)/16:1(9Z))Show
YMDB12194CDP-DG(14:1(9Z)/18:0)Show
YMDB12195CDP-DG(14:1(9Z)/18:1(11Z))Show
YMDB12196CDP-DG(14:1(9Z)/18:1(9Z))Show
YMDB12197CDP-DG(14:1(9Z)/20:0)Show
YMDB12198CDP-DG(14:1(9Z)/20:1(11Z))Show
YMDB12199CDP-DG(14:1(9Z)/20:1(13Z))Show
YMDB12200CDP-DG(14:1(9Z)/22:0)Show
YMDB12202CDP-DG(14:1(9Z)/22:1(9Z))Show
YMDB12213CDP-DG(15:0/15:0)Show
YMDB12214CDP-DG(15:0/15:1(11Z))Show
YMDB12215CDP-DG(15:0/15:1(9Z))Show
YMDB12216CDP-DG(15:0/16:0)Show
YMDB12217CDP-DG(15:0/16:1(11Z))Show
YMDB12218CDP-DG(15:0/16:1(9Z))Show
YMDB12219CDP-DG(15:0/18:0)Show
YMDB12220CDP-DG(15:0/18:1(11Z))Show
YMDB12221CDP-DG(15:0/18:1(9Z))Show
YMDB12222CDP-DG(15:0/20:0)Show
YMDB12223CDP-DG(15:0/20:1(11Z))Show
YMDB12224CDP-DG(15:0/20:1(13Z))Show
YMDB12247CDP-DG(15:1(11Z)/15:1(11Z))Show
YMDB12248CDP-DG(15:1(11Z)/15:1(9Z))Show
YMDB12249CDP-DG(15:1(11Z)/16:0)Show
YMDB12250CDP-DG(15:1(11Z)/16:1(11Z))Show
YMDB12251CDP-DG(15:1(11Z)/16:1(9Z))Show
YMDB12252CDP-DG(15:1(11Z)/18:0)Show
YMDB12253CDP-DG(15:1(11Z)/18:1(11Z))Show
YMDB12254CDP-DG(15:1(11Z)/18:1(9Z))Show
YMDB12255CDP-DG(15:1(11Z)/20:0)Show
YMDB12256CDP-DG(15:1(11Z)/20:1(11Z))Show
YMDB12257CDP-DG(15:1(11Z)/20:1(13Z))Show
YMDB12280CDP-DG(15:1(9Z)/15:1(11Z))Show
YMDB12281CDP-DG(15:1(9Z)/15:1(9Z))Show
YMDB12282CDP-DG(15:1(9Z)/16:0)Show
YMDB12283CDP-DG(15:1(9Z)/16:1(11Z))Show
YMDB12284CDP-DG(15:1(9Z)/16:1(9Z))Show
YMDB12285CDP-DG(15:1(9Z)/18:0)Show
YMDB12286CDP-DG(15:1(9Z)/18:1(11Z))Show
YMDB12287CDP-DG(15:1(9Z)/18:1(9Z))Show
YMDB12288CDP-DG(15:1(9Z)/20:0)Show
YMDB12289CDP-DG(15:1(9Z)/20:1(11Z))Show
YMDB12290CDP-DG(15:1(9Z)/20:1(13Z))Show
YMDB12313CDP-DG(16:0/16:0)Show
YMDB12314CDP-DG(16:0/16:1(11Z))Show
YMDB12315CDP-DG(16:0/16:1(9Z))Show
YMDB12316CDP-DG(16:0/18:0)Show
YMDB12317CDP-DG(16:0/18:1(11Z))Show
YMDB12318CDP-DG(16:0/18:1(9Z))Show
YMDB12319CDP-DG(16:0/20:0)Show
YMDB12320CDP-DG(16:0/20:1(11Z))Show
YMDB12321CDP-DG(16:0/20:1(13Z))Show
YMDB12344CDP-DG(16:1(11Z)/16:1(11Z))Show
YMDB12345CDP-DG(16:1(11Z)/16:1(9Z))Show
YMDB12346CDP-DG(16:1(11Z)/18:0)Show
YMDB12347CDP-DG(16:1(11Z)/18:1(11Z))Show
YMDB12348CDP-DG(16:1(11Z)/18:1(9Z))Show
YMDB12349CDP-DG(16:1(11Z)/20:0)Show
YMDB12350CDP-DG(16:1(11Z)/20:1(11Z))Show
YMDB12351CDP-DG(16:1(11Z)/20:1(13Z))Show
YMDB12374CDP-DG(16:1(9Z)/16:1(11Z))Show
YMDB12375CDP-DG(16:1(9Z)/16:1(9Z))Show
YMDB12460CDP-DG(18:1(9Z)/18:1(9Z))Show
GO Classification
Function
CDP-diacylglycerol biosynthetic process
mitochondrial matrix
extrinsic component of mitochondrial inner membrane
phosphatidate cytidylyltransferase activity
cardiolipin biosynthetic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1158 bp ATGTTACGAGTTTCTGAAAATGGTCTACGGTTTCTGCTGAAATGCCATTCAACGAACGTA AGCATGTTTAATAGGCTTCTGAGTACTCAAATAAAGGAGGGGAGAAGTTCCATAGATGAT GCTGGCATTATCCCCGATGGAACTATTAACGAAAGGCCGAATCACTACATCGAGGGAATT ACTAAAGGCAGTGATCTGGACCTCTTGGAAAAAGGTATAAGAAAAACTGACGAAATGACT TCCAATTTTACAAATTATATGTACAAGTTTCACAGATTGCCCCCCAACTATGGAAGTAAC CAGCTCATTACTATCGATAAGGAACTTCAAAAGGAACTGGATGGGGTAATGTCATCCTTC AAAGCTCCGTGCCGGTTTGTATTTGGTTACGGCTCAGGAGTTTTCGAACAAGCGGGATAT TCCAAAAGTCATAGCAAACCTCAAATCGATATAATCTTGGGCGTCACATATCCATCACAT TTTCACTCTATTAATATGAGGCAGAATCCGCAACATTATTCAAGTTTGAAATACTTCGGT TCCGAGTTCGTGTCTAAATTTCAACAGATCGGCGCAGGCGTATATTTTAATCCATTTGCA AATATAAATGGACACGACGTAAAATATGGGGTGGTTTCTATGGAAACACTTTTAAAGGAC ATAGCTACTTGGAATACATTCTATTTAGCAGGACGACTACAAAAGCCTGTAAAAATATTG AAGAATGATTTGAGAGTGCAATATTGGAACCAATTAAACTTAAAAGCTGCAGCTACTTTG GCCAAACATTACACCTTAGAGAAAAATAACAATAAGTTTGACGAATTCCAATTTTACAAG GAGATCACTGCCTTAAGTTATGCAGGTGATATTAGATACAAACTGGGTGGAGAAAATCCC GACAAAGTTAACAACATTGTTACCAAAAACTTTGAAAGATTTCAAGAGTATTACAAGCCG ATTTACAAAGAAGTGGTCCTAAATGATTCATTTTATCTTCCAAAAGGGTTCACATTAAAG AATACTCAGAGACTTTTGCTCAGCCGTATTAGTAAATCAAGTGCATTACAAACTATTAAA GGTGTTTTCACAGCTGGAATCACAAAGTCAATTAAGTATGCTTGGGCCAAAAAACTAAAA TCGATGAGGAGAAGCTAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues385
Protein Molecular Weight44199.33
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Phosphatidate cytidylyltransferase, mitochondrial MLRVSENGLRFLLKCHSTNVSMFNRLLSTQIKEGRSSIDDAGIIPDGTINERPNHYIEGI TKGSDLDLLEKGIRKTDEMTSNFTNYMYKFHRLPPNYGSNQLITIDKELQKELDGVMSSF KAPCRFVFGYGSGVFEQAGYSKSHSKPQIDIILGVTYPSHFHSINMRQNPQHYSSLKYFG SEFVSKFQQIGAGVYFNPFANINGHDVKYGVVSMETLLKDIATWNTFYLAGRLQKPVKIL KNDLRVQYWNQLNLKAAATLAKHYTLEKNNNKFDEFQFYKEITALSYAGDIRYKLGGENP DKVNNIVTKNFERFQEYYKPIYKEVVLNDSFYLPKGFTLKNTQRLLLSRISKSSALQTIK GVFTAGITKSIKYAWAKKLKSMRRS
References
External Links
ResourceLink
Saccharomyces Genome Database TAM41
Uniprot IDP53230
Uniprot NameTAM41
General ReferenceNot Available