You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTransaldolase NQM1
Synonyms
  • Non-quiescent mutant protein 1
Gene NameNQM1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionTransaldolase is important for the balance of metabolites in the pentose-phosphate pathway
Cellular LocationNot Available
SMPDB Pathways
xylitol degradationPW002433 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
SMPDB Reactions
D-Glyceraldehyde 3-phosphate + D-Sedoheptulose 7-phosphateD-Erythrose 4-phosphate + β-D-fructofuranose 6-phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00115D-Glyceraldehyde 3-phosphateShow
YMDB00196D-Sedoheptulose 7-phosphateShow
YMDB00223D-Erythrose 4-phosphateShow
YMDB00752Sedoheptulose 7-phosphateShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
transferase activity, transferring aldehyde or ketonic groups
transaldolase activity
catalytic activity
transferase activity
Process
hexose metabolic process
glucose metabolic process
glucose catabolic process
pentose-phosphate shunt
metabolic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR043C
Gene Sequence>1002 bp ATGTCAGAACCTTCAGAGAAAAAACAAAAAGTTGCTACCTCATCTTTAGAACAATTAAAA AAGGCCGGGACCCATGTGGTTGCTGATTCGGGTGATTTTGAGGCTATTTCGAAGTATGAA CCACAGGATTCAACAACTAACCCTTCTCTGATATTGGCTGCTTCAAAGTTGGAGAAATAT GCGAGGTTTATCGACGCTGCCGTTGAATATGGTAGAAAGCATGGCAAAACTGATCATGAG AAAATCGAGAACGCCATGGATAAGATTTTGGTGGAATTCGGCACCCAGATTTTGAAGGTA GTCCCAGGAAGGGTTTCCACTGAAGTAGACGCAAGGTTATCTTTTGATAAGAAGGCGACG GTGAAGAAGGCTCTCCACATCATCAAACTATATAAAGATGCGGGAGTACCTAAAGAAAGA GTCTTGATCAAGATAGCTTCTACGTGGGAGGGTATCCAAGCTGCTAGAGAATTGGAAGTA AAGCATGGTATTCATTGTAATATGACATTACTGTTTTCCTTTACGCAAGCAGTAGCCTGT GCGGAGGCAAATGTCACATTGATCTCCCCATTTGTTGGAAGGATTATGGACTTTTACAAG GCCCTTTCAGGCAAAGACTATACTGCAGAAACTGATCCCGGTGTTCTTTCTGTTAAGAAG ATATACAGTTACTATAAGAGGCACGGTTATGCAACTGAGGTAATGGCGGCTTCTTTCAGG AATTTAGATGAATTGAAGGCGTTAGCCGGTATTGATAATATGACTCTCCCACTGAACCTT CTAGAACAGTTATATGAATCAACAGATCCTATTGAAAACAAATTGAATTCTGAGAGTGCT AAGGAAGAAGGCGTCGAAAAAGTCTCTTCTATCAACGACGAGCCTCATTTCAGATATGTT TTAAACGAAGATCAAATGGCTACAGAAAAACTATCAGATGGTATCAGAAAATTCTCCGCA GACATTGAAGCACTGTACAAACTGGTTGAAGAAAAAATGTGA
Protein Properties
Pfam Domain Function
Protein Residues333
Protein Molecular Weight37253.30078
Protein Theoretical pI6.33
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Transaldolase NQM1 MSEPSEKKQKVATSSLEQLKKAGTHVVADSGDFEAISKYEPQDSTTNPSLILAASKLEKY ARFIDAAVEYGRKHGKTDHEKIENAMDKILVEFGTQILKVVPGRVSTEVDARLSFDKKAT VKKALHIIKLYKDAGVPKERVLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVAC AEANVTLISPFVGRIMDFYKALSGKDYTAETDPGVLSVKKIYSYYKRHGYATEVMAASFR NLDELKALAGIDNMTLPLNLLEQLYESTDPIENKLNSESAKEEGVEKVSFINDEPHFRYV LNEDQMATEKLSDGIRKFSADIEALYKLVEEKM
References
External Links
ResourceLink
Saccharomyces Genome Database NQM1
Uniprot IDP53228
Uniprot NameTAL2_YEAST
GenBank Gene IDAY557832
Genebank Protein ID45269555
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Huang, H., Rong, H., Li, X., Tong, S., Zhu, Z., Niu, L., Teng, M. (2008). "The crystal structure and identification of NQM1/YGR043C, a transaldolase from Saccharomyces cerevisiae." Proteins 73:1076-1081.18831051