You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDolichyldiphosphatase
Synonyms
  • Dolichyl pyrophosphate phosphatase
Gene NameCAX4
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionNon-essential protein which is required for efficient N- glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00927Dolichyl diphosphateShow
YMDB00928Dolichol-20Show
YMDB00941dolichyl phosphateShow
GO Classification
Component
cell part
membrane
Function
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 7
LocusYGR036C
Gene Sequence>720 bp ATGAATAGTACCGCCGCTGCAATAAATCCAAATCCAAATGTTATACCATTCGATGACACA TACATTCTCTATGATTCGCATGACTTTCTATCATTCCTTAGTGCATATTTCTCGCTGATG CCCATCCTAGTGCTAGCTTTTTATTTGTCGTGGTTTATCATCACAAGAGAGTTAGAAGCC TGCATTGTAGCCTTTGGCCAATTGATGAACGAAATATTCAATAACGTGATCAAGAATATA ATAAAACAGCCACGCCCCGTATCGTTCGGTGCGTCGTTCCAAAATGACACTATAAGATCC GGTTACGGGATGCCCAGTGCACACTCCCAATTCATGGGGTTTTGTTTTACCTATAACTCT CTGAAGATATACACTTCCTGGAAGAATCTAAACTTCTTAGAAAAATGCATTTTTTCTGGT GCATTGGCTTTATTATCGTTTTGCGTTTGCTTTTCCAGAGTTTACTTGCACTACCACAAT TTAGATCAAGTAATCGTGGGATTCAGCGTGGGGGCACTGACTGGATCACTTTATTTTTTT ATAGTTGGCATCATAAGAGAGCTTGGTTTAATCAATTGGTTTTTAAAACTACGTATTGTC AGATTATTTTACATGACAGATTCTTACAATCTGGCGCCTTTGACATTGAAAGAGAATTAC GAGGCGTATTGGAAAAGAATAAATCAGCGATCTTTCAATGATAAATCCAAAAGGGATTAG
Protein Properties
Pfam Domain Function
Protein Residues239
Protein Molecular Weight27648.80078
Protein Theoretical pI8.65
Signalling Regions
  • None
Transmembrane Regions
  • 35-55
  • 132-152
  • 165-185
Protein Sequence>Dolichyldiphosphatase MNSTAAAINPNPNVIPFDDTYILYDSHDFLSFLSAYFSLMPILVLAFYLSWFIITRELEA CIVAFGQLMNEIFNNVIKNIIKQPRPVSFGASFQNDTIRSGYGMPSAHSQFMGFCFTYNS LKIYTSWKNLNFLEKCIFSGALALLSFCVCFSRVYLHYHNLDQVIVGFSVGALTGSLYFF IVGIIRELGLINWFLKLRIVRLFYMTDSYNLAPLTLKENYEAYWKRINQRSFNDKSKRD
References
External Links
ResourceLink
Saccharomyces Genome Database CAX4
Uniprot IDP53223
Uniprot NameCAX4_YEAST
GenBank Gene IDAY557771
Genebank Protein ID45269433
General Reference
  • Deutschbauer, A. M., Davis, R. W. (2005). "Quantitative trait loci mapped to single-nucleotide resolution in yeast." Nat Genet 37:1333-1340.16273108
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • van Berkel, M. A., Rieger, M., te Heesen, S., Ram, A. F., van den Ende, H., Aebi, M., Klis, F. M. (1999). "The Saccharomyces cerevisiae CWH8 gene is required for full levels of dolichol-linked oligosaccharides in the endoplasmic reticulum and for efficient N-glycosylation." Glycobiology 9:243-253.10024662
  • Fernandez, F., Rush, J. S., Toke, D. A., Han, G. S., Quinn, J. E., Carman, G. M., Choi, J. Y., Voelker, D. R., Aebi, M., Waechter, C. J. (2001). "The CWH8 gene encodes a dolichyl pyrophosphate phosphatase with a luminally oriented active site in the endoplasmic reticulum of Saccharomyces cerevisiae." J Biol Chem 276:41455-41464.11504728
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258