Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNicotinamidase
Synonyms
  • Nicotine deamidase
  • NAMase
Gene NamePNC1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate
Cellular LocationCytoplasm. Nucleus. Peroxisome.
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB Reactions
Niacinamide + waterNicotinic acid + Ammonium
KEGG Reactions
water + NiacinamideNicotinic acid + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00224Nicotinic acidShow
YMDB00274NiacinamideShow
YMDB00423AmmoniumShow
YMDB00890waterShow
YMDB00976PyrazinecarboxamideShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL037C
Gene Sequence>651 bp ATGAAGACTTTAATTGTTGTTGATATGCAAAATGATTTTATTTCACCTTTAGGTTCCTTG ACTGTTCCAAAAGGTGAGGAATTAATCAATCCTATCTCGGATTTGATGCAAGATGCTGAT AGAGACTGGCACAGGATTGTGGTCACCAGAGATTGGCACCCTTCCAGACATATTTCGTTC GCAAAGAACCATAAAGATAAAGAACCCTATTCAACATACACCTACCACTCTCCAAGGCCA GGCGATGATTCCACGCAAGAGGGTATTTTGTGGCCCGTACACTGTGTGAAAAACACCTGG GGTAGTCAATTGGTTGACCAAATAATGGACCAAGTGGTCACTAAGCATATTAAGATTGTC GACAAGGGTTTCTTGACTGACCGTGAATACTACTCCGCCTTCCACGACATCTGGAACTTC CATAAGACCGACATGAACAAGTACTTAGAAAAGCATCATACAGACGAGGTTTACATTGTC GGTGTAGCTTTGGAGTATTGTGTCAAAGCCACCGCCATTTCCGCTGCAGAACTAGGTTAT AAGACCACTGTCCTGCTGGATTACACAAGACCCATCAGCGATGATCCCGAAGTCATCAAT AAGGTTAAGGAAGAGTTGAAGGCCCACAACATCAATGTCGTGGATAAATAA
Protein Properties
Pfam Domain Function
Protein Residues216
Protein Molecular Weight24993.19922
Protein Theoretical pI6.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Nicotinamidase MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISF AKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIV DKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGY KTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
References
External Links
ResourceLink
Saccharomyces Genome Database PNC1
Uniprot IDP53184
Uniprot NamePNC1_YEAST
GenBank Gene IDAY558481
Genebank Protein ID45270852
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghislain, M., Talla, E., Francois, J. M. (2002). "Identification and functional analysis of the Saccharomyces cerevisiae nicotinamidase gene, PNC1." Yeast 19:215-224.11816029
  • Bernheim, M. L. (1967). "Hydrolysis of nicotinyl hydroxamate by a yeast nicotinamidase." Arch Biochem Biophys 120:186-191.6058082
  • Calbreath, D. F., Joshi, J. G. (1971). "Inhibition of nicotinamidase by nicotinamide adenine dinucleotide." J Biol Chem 246:4334-4339.4326215
  • Anderson, R. M., Bitterman, K. J., Wood, J. G., Medvedik, O., Sinclair, D. A. (2003). "Nicotinamide and PNC1 govern lifespan extension by calorie restriction in Saccharomyces cerevisiae." Nature 423:181-185.12736687
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gallo, C. M., Smith, D. L. Jr, Smith, J. S. (2004). "Nicotinamide clearance by Pnc1 directly regulates Sir2-mediated silencing and longevity." Mol Cell Biol 24:1301-1312.14729974
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Hu, G., Taylor, A. B., McAlister-Henn, L., Hart, P. J. (2007). "Crystal structure of the yeast nicotinamidase Pnc1p." Arch Biochem Biophys 461:66-75.17382284