You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUDP-N-acetylglucosamine transferase subunit ALG13
Synonyms
  • Asparagine-linked glycosylation protein 13
Gene NameALG13
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring hexosyl groups
Specific FunctionInvolved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway
Cellular LocationEndoplasmic reticulum
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB Reactions
N-acetyl-α-D-glucosaminyl-diphosphodolichol + Uridine diphosphate-N-acetylglucosamine (N-Acetylglucosaminyl)2-diphosphodolichol + Uridine 5'-diphosphate + hydron
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00862hydronShow
YMDB00864Dolichol phosphateShow
YMDB00934N-acetyl-D-glucosaminyldiphosphodolicholShow
YMDB16232(N-Acetylglucosaminyl)2-diphosphodolicholShow
YMDB16336N-acetyl-α-D-glucosaminyl-diphosphodolicholShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
binding
carbohydrate binding
catalytic activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
lipid metabolic process
cellular lipid metabolic process
lipid modification
lipid glycosylation
Gene Properties
Chromosome Locationchromosome 7
LocusYGL047W
Gene Sequence>609 bp ATGGGTATTATTGAAGAAAAGGCTCTTTTTGTTACGTGTGGGGCAACGGTGCCATTTCCA AAGCTCGTCTCATGTGTGCTAAGCGACGAATTCTGCCAAGAATTGATTCAATATGGATTC GTACGTCTAATCATTCAGTTTGGGAGAAACTACAGTTCTGAATTTGAGCATTTAGTGCAA GAACGCGGGGGCCAAAGAGAAAGCCAAAAAATTCCAATTGACCAGTTTGGCTGTGGCGAC ACCGCAAGACAGTATGTCCTGATGAACGGGAAATTAAAGGTGATCGGGTTTGACTTTTCG ACCAAGATGCAAAGTATTATACGTGATTATTCAGATTTGGTCATATCACACGCTGGAACG GGCTCTATACTAGATTCTCTACGGTTGAATAAACCGTTGATAGTTTGCGTAAACGATTCT TTGATGGATAACCACCAGCAGCAGATAGCAGACAAGTTTGTAGAGTTGGGCTACGTATGG TCTTGTGCACCCACTGAAACAGGTTTGATAGCTGGTTTACGTGCATCTCAAACAGAGAAA CTCAAACCATTCCCAGTTTCTCATAACCCGTCATTTGAGCGATTGCTAGTTGAAACTATA TACAGCTAG
Protein Properties
Pfam Domain Function
Protein Residues202
Protein Molecular Weight22660.90039
Protein Theoretical pI5.66
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>UDP-N-acetylglucosamine transferase subunit ALG13 MGIIEEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQ ERGGQRESQKIPIDQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGT GSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAPTETGLIAGLRASQTEK LKPFPVSHNPSFERLLVETIYS
References
External Links
ResourceLink
Saccharomyces Genome Database ALG13
Uniprot IDP53178
Uniprot NameALG13_YEAST
GenBank Gene IDZ72569
Genebank Protein ID1322537
General Reference
  • Feuermann, M., de Montigny, J., Potier, S., Souciet, J. L. (1997). "The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes." Yeast 13:861-869.9234674
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chantret, I., Dancourt, J., Barbat, A., Moore, S. E. (2005). "Two proteins homologous to the N- and C-terminal domains of the bacterial glycosyltransferase Murg are required for the second step of dolichyl-linked oligosaccharide synthesis in Saccharomyces cerevisiae." J Biol Chem 280:9236-9242.15615718
  • Gao, X. D., Tachikawa, H., Sato, T., Jigami, Y., Dean, N. (2005). "Alg14 recruits Alg13 to the cytoplasmic face of the endoplasmic reticulum to form a novel bipartite UDP-N-acetylglucosamine transferase required for the second step of N-linked glycosylation." J Biol Chem 280:36254-36262.16100110