You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA pseudouridine synthase 2
Synonyms
  • tRNA pseudouridylate synthase 2
  • tRNA-uridine isomerase 2
Gene NamePUS2
Enzyme Class
Biological Properties
General FunctionInvolved in RNA binding
Specific FunctionFormation of pseudouridine in the anticodon stem and loop of transfer RNAs
Cellular LocationNucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Uracil + alpha-D-ribose 5-phosphatewater + Pseudouridine 5'-phosphate
Metabolites
YMDB IDNameView
YMDB00098UracilShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00780Pseudouridine 5'-phosphateShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
isomerase activity
intramolecular transferase activity
nucleic acid binding
pseudouridine synthase activity
RNA binding
catalytic activity
binding
Process
cellular macromolecule metabolic process
RNA metabolic process
RNA modification
pseudouridine synthesis
metabolic process
macromolecule metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL063W
Gene Sequence>1113 bp ATGCTCTTAGGTTACTGTGGCAGCGGATACTATGGAATGCAATACAACCCACCACACAAG ACGATTGAAGGTGAGATTCTCACCAAGCTCTTCGACGTAGGAGCCATTTCCGAAGAAAAT TCATTGGCACCGAAGAAAAATTCCTTTATGGCAGCGGCAAGAACAGACAAGGGTGTACAC GCTATGTTGAATCTACTGTCGCTAAAGATCACATTGCGAGAGGACACAGTAGCGAAGTTA AACGCCGCACTACCGCCCGAAATACGCGTGTGGGGTATCCAGCCTGTCAATAAAAAGTTT AATGCTAGATCCGCGTGCGATTCTCGATGGTACCAATACCTTATCCCAGAATTTATACTC ATTGGTCCACCCCGGAGTTCTCTTTTGCATCGAAACGTGGGGGGATGCTACCGCGAAGAC GGCTCGCAAGAGGTGTGGGATACGTTCCTGGAACAGACGCGTGGGAGATTTAGCGGGGAT GAGCTGTGCCGTTTGCAGGACACTGCACAGAAACTAAGCGAGAGCGATCCTTTGGTACAA GACTACGTGGGGCTATTGAGCGGTACCCTTAGCGGCTACTGCTTGTCGCCCTCGAAGCTG GACGCGTTTGAGGCAGCCATGCAGGAGTACGTGGGAACGCATAATTTTCACAACTTTACC ACAGGAAAGCTTTGGGGGGATCCTAGTGCTCAGCGCCATATCAAAAAGGTTGTAGTGTCG CAGGCCTCACCGGGATGGATATGTGTGCGGATCCACGGGCAGTCGTTTATGTTGCATCAG ATTCGACGAATGGTAGCGCTTGCCGTACTTGCAGCCCGTTGCCAATTGCCGCCTAATATT GTACGTAACTATTTTAACGCCGGGCCTAGGAAATACATTCCGAGGGCGCCCGCACAAGGC CTATTATTAGAGGGACCTGTGTTTGACGGGTATAACACTAAGTTGCGCAATTTGCTGTAT TGCGAAATCCGCCCGGACGATATCACTCTTGAGCGCATGTGCCGTTTCCGAGAACGCCAG ATCTGTACTGCGATCGCACACGAGGAGACACAGCGTCACGTGTTTTGCCATTTTGTACGA CAAATGAACCGCCTGGCCACGCCTCTAATCTAG
Protein Properties
Pfam Domain Function
Protein Residues370
Protein Molecular Weight41874.80078
Protein Theoretical pI8.92
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA pseudouridine synthase 2 MLLGYCGSGYYGMQYNPPHKTIEGEILTKLFDVGAISEENSLAPKKNSFMAAARTDKGVH AMLNLLSLKITLREDTVAKLNAALPPEIRVWGIQPVNKKFNARSACDSRWYQYLIPEFIL IGPPRSSLLHRNVGGSYREDGSQEVWDTFLEQTRGRFSGDELCRLQDTAQKLSESDPLVQ DYVGLLSGTLSGYCLSPSKLDAFEAAMQEYVGTHNFHNFTTGKLWGDPSAQRHIKKVVVS QASPGWICVRIHGQSFMLHQIRRMVALAVLAARCQLPPNIVRNYFNAGPRKYIPRAPAQG LLLEGPVFDGYNTKLRNLLYCEIRPDDITLERMCRFRERQICTAIAHEETQRHVFCHFVR QMNRLATPLI
References
External Links
ResourceLink
Saccharomyces Genome Database PUS2
Uniprot IDP53167
Uniprot NamePUS2_YEAST
GenBank Gene IDX80674
Genebank Protein ID1403093
General Reference
  • Simos, G., Tekotte, H., Grosjean, H., Segref, A., Sharma, K., Tollervey, D., Hurt, E. C. (1996). "Nuclear pore proteins are involved in the biogenesis of functional tRNA." EMBO J 15:2270-2284.8641292
  • Feuermann, M., de Montigny, J., Potier, S., Souciet, J. L. (1997). "The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes." Yeast 13:861-869.9234674
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869