You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameVitamin B6 transporter TPN1
Synonyms
  • Transport of pyridoxine protein 1
Gene NameTPN1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in nucleobase transmembrane transporter activity
Specific FunctionThiamine-regulated, high affinity import carrier of pyridoxine, pyridoxal and pyridoxamine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00037PyridoxineShow
YMDB00651CytosineShow
YMDB00698GuanineShow
YMDB00862hydronShow
YMDB00887AdenineShow
GO Classification
Component
membrane
cell part
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
nucleobase, nucleoside, nucleotide and nucleic acid transmembrane transporter activity
nucleobase transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
nucleobase, nucleoside, nucleotide and nucleic acid transport
Gene Properties
Chromosome Locationchromosome 7
LocusYGL186C
Gene Sequence>1740 bp ATGAATAGGGACAACATGGACACAACAAAGCGCAAAGAAGATCATACAAAGCATACTACT GATGTAATAGAATTTTACGAAGAAGGAACCGCAGCTTCTTCTTTAAACATAGCCACAGAA AAGGCCAACTCAAGTCCGTCCATTTTGAGAAGAATTATCAACAGGGCGGCATGGCTTTCT AAGAAAGTGGACGCAATGGGAGTAGAGTCTACCGGTATTCAGAGGATATCTCCCTATGAA CGAGGAACATCAAAGAAACAATTTTTGCATGTCGCGGGGCTATGGTTGAGTGCCACAGGT GGTTTGTCTTCCATGTCGTCGTTTTTATTAGGCCCTCTGCTTTTCGGTTTAAGCTTTAGA GAATCCGTAGCCTCCAGTTTAATATCGGTAACAATTGGTTGCTTAATTGCTGCCTATTGC TCGATCATGGGACCGCAGTCCGGTTGCAGACAGATGGTAACAGCTAGATACCTGTTCGGA TGGTGGTTTGTTAAATTAGTTGCATTAGCTTCCATTATCGGTGTCATGGGTTGGTCTGTG GTTAATTCCGTGGTTGGGGGTGAAATGTTAGCTGCTATTTCTAATGATAAAGTACCCCTA TGGGTAGGGATTGTCATAGTGACCGTATGCTCCTTTTTAGTTGCCATTTTCGGTATCAAA CAAGTCATTAAAGTGGAAACTTACTTATCCGTACCCGTCCTGACAGCATTTTTACTACTG TACATTTCATCAAGTGATAAATACAGCTTCGTCAATGCATACGTTTCAAAGGGAAATTTG GACTCTTCCACCCGAAAGGGCAACTGGATGAGTTTTTTTTCATTATGCTATAGTATTACG GCTACTTGGGGGTCTATTACAGCAGACTATTATATATTGTTCCCAGAAGATACACCATAT ATTCAAATTTTTTGCCTAACGTTTTTTGGAACATTTTTGCCTACCTGTTTCGTCGGAATC TTAGGTCTCTTACTAGCTTCTGTTGCCATGTCGTATAAGCCTTGGTCAGTCGAGTACGAT TCCCATGGAATGGGTGGTCTACTTTGGGCAGGTTTTCAGCGTTGGAACGGCTTCGGAAAG TTCTGCGTGGTAGTACTGGTATTCAGTTTGGTATCCAACAACATCATCAATACGTATTCG GCAGCATTCTCCATCCAACTTTCTAGTGTGTTTTGTGCAAAAATCCCTCGCTGGTTCTGG TCTATTGTTTGTACTATAATTTGTTTGGTATGCGCATTAATAGGTCGTAATCATTTTAGT ACTATTTTGGGAAATTTCCTACCAATGATAGGCTACTGGATTAGCATGTACTTTATCTTA TTATTCGAAGAGAATTTAGTATTCAGAAGGTTTTTCTTACATTTGTACACCAAAGAGTTT CCTACAGTTACAGGAGAAATAAATGGACCGGAACTTGTTGGATCTTCAAAAGAAGTGGAG AAAGATGCAGTTACTAATATCCATTTGTTAAAAAGAAAACATAAGGTGACTAAACATCGT TACAATTGGGACAAATGGGAAGATTATGAGGTTTTAACGCACGGTTATGCAGCAACATTT GCGTTTATTGTAGGAGTTGCTGGTGTGGTAGTTGGTATGGCGCAAGCCTATTGGATTGGC CCAATTGCTGCCAAATTTGGTGAATATGGTGGTGATGTCGCAATGTGGTTAAGTATGGCG TTCTCAGGTGTTGTATACCCTCCTTGTAGATACTTAGAGCTACGTAAATTTGGTCGTTAA
Protein Properties
Pfam Domain Function
Protein Residues579
Protein Molecular Weight64545.80078
Protein Theoretical pI8.83
Signalling Regions
  • None
Transmembrane Regions
  • 99-119
  • 123-143
  • 158-178
  • 199-219
  • 222-242
  • 275-295
  • 303-323
  • 363-383
  • 395-415
  • 422-442
  • 520-540
  • 546-566
Protein Sequence>Vitamin B6 transporter TPN1 MNRDNMDTTKRKEDHTKHTTDVIEFYEEGTAASSLNIATEKANSSPSILRRIINRAAWLS KKVDAMGVESTGIQRISPYERGTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFGLSFR ESVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFGWWFVKLVALASIIGVMGWSV VNSVVGGEMLAAISNDKVPLWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVPVLTAFLLL YISSSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLCYSITATWGSITADYYILFPEDTPY IQIFCLTFFGTFLPTCFVGILGLLLASVAMSYKPWSVEYDSHGMGGLLWAGFQRWNGFGK FCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAKIPRWFWSIVCTIICLVCALIGRNHFS TILGNFLPMIGYWISMYFILLFEENLVFRRFFLHLYTKEFPTVTGEINGPELVGSSKEVE KDAVTNIHLLKRKHKVTKHRYNWDKWEDYEVLTHGYAATFAFIVGVAGVVVGMAQAYWIG PIAAKFGEYGGDVAMWLSMAFSGVVYPPCRYLELRKFGR
References
External Links
ResourceLink
Saccharomyces Genome Database TPN1
Uniprot IDP53099
Uniprot NameTPN1_YEAST
GenBank Gene IDX91489
Genebank Protein ID1143561
General Reference
  • Stolz, J., Vielreicher, M. (2003). "Tpn1p, the plasma membrane vitamin B6 transporter of Saccharomyces cerevisiae." J Biol Chem 278:18990-18996.12649274
  • Coglievina, M., Klima, R., Bertani, I., Delneri, D., Zaccaria, P., Bruschi, C. V. (1997). "Sequencing of a 40.5 kb fragment located on the left arm of chromosome VII from Saccharomyces cerevisiae." Yeast 13:55-64.9046087
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258