You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSuppressor of disruption of TFIIS
SynonymsNot Available
Gene NameSDT1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCould be an enzyme that inactivates 6-azauracil by modifying it
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Cytidine monophosphate + waterphosphate + Cytidine
water + Uridine 5'-monophosphatephosphate + Uridine
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00051CytidineShow
YMDB00127UridineShow
YMDB00406Cytidine monophosphateShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL224C
Gene Sequence>843 bp ATGACTGTTGAATATACTGCATCCGATTTGGCAACCTATCAGAATGAGGTGAACGAACAA ATTGCCAAGAATAAAGCACATCTTGAATCATTGACTCATCCAGGTTCGAAAGTGACATTT CCGATCGATCAAGATATTTCTGCTACACCTCAAAACCCGAACTTAAAAGTTTTCTTTTTT GATATCGACAACTGTCTCTATAAATCATCCACGAGAATTCACGATCTTATGCAACAATCT ATACTGAGGTTCTTTCAAACACACTTGAAACTATCACCTGAAGATGCTCACGTTTTGAAT AACTCTTACTACAAAGAGTATGGACTTGCCATAAGGGGACTTGTAATGTTCCACAAAGTG AACGCACTGGAATATAACCGGCTTGTGGATGATTCCTTACCACTACAAGATATCTTGAAA CCTGATATACCATTAAGGAATATGCTGTTGAGATTGAGACAATCGGGAAAGATTGATAAA TTGTGGCTTTTCACCAACGCTTATAAAAACCACGCAATACGTTGCCTGAGATTGTTGGGT ATAGCGGATTTATTTGATGGATTGACATATTGTGACTACTCTAGGACAGATACGCTGGTC TGCAAACCACATGTTAAAGCATTTGAAAAAGCCATGAAGGAAAGCGGGTTGGCAAGATAC GAGAATGCTTATTTTATAGATGACAGTGGGAAAAACATCGAGACAGGTATCAAATTGGGC ATGAAAACATGTATTCATTTAGTTGAGAATGAAGTAAATGAAATTTTGGGGCAAACACCA GAAGGCGCTATTGTCATTAGTGATATATTGGAGTTACCACACGTTGTGTCCGACCTGTTC TAA
Protein Properties
Pfam Domain Function
Protein Residues280
Protein Molecular Weight31968.40039
Protein Theoretical pI6.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Suppressor of disruption of TFIIS MTVEYTASDLATYQNEVNEQIAKNKAHLESLTHPGSKVTFPIDQDISATPQNPNLKVFFF DIDNCLYKSSTRIHDLMQQSILRFFQTHLKLSPEDAHVLNNSYYKEYGLAIRGLVMFHKV NALEYNRLVDDSLPLQDILKPDIPLRNMLLRLRQSGKIDKLWLFTNAYKNHAIRCLRLLG IADLFDGLTYCDYSRTDTLVCKPHVKAFEKAMKESGLARYENAYFIDDSGKNIETGIKLG MKTCIHLVENEVNEILGQTPEGAIVISDILELPHVVSDLF
References
External Links
ResourceLink
Saccharomyces Genome Database SDT1
Uniprot IDP53078
Uniprot NameSDT1_YEAST
GenBank Gene IDAY692802
Genebank Protein ID51013055
General Reference
  • Shimoaraiso, M., Nakanishi, T., Kubo, T., Natori, S. (2000). "Transcription elongation factor S-II confers yeast resistance to 6-azauracil by enhancing expression of the SSM1 gene." J Biol Chem 275:29623-29627.10858443
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287