You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylserine decarboxylase proenzyme 2
Synonyms
  • Phosphatidylserine decarboxylase 2 beta chain
  • Phosphatidylserine decarboxylase 2 alpha chain
Gene NamePSD2
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionMay be involved in the regulation of phospholipid biosynthesis and interorganelle trafficking of phosphatidylserine
Cellular LocationGolgi apparatus, Golgi stack. Vacuole
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB ReactionsNot Available
KEGG Reactions
PC(14:0/16:0)PE(14:0/16:1(9Z)) + Carbon dioxide
Metabolites
YMDB IDNameView
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
phosphatidylserine decarboxylase activity
catalytic activity
Process
organophosphate metabolic process
phospholipid metabolic process
phospholipid biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR170W
Gene Sequence>3417 bp ATGAGGATTATTAAGGGCAGAAAGCGAGGCAAGAACAAGAAGCCAACGCTAATTTTAAAA ATTCATGTCATTCAAGCTGAAAATATTGAAGCCTTGAAGACATTCAATTGTAACCCGGTA TGTTTTGTTACCACTAATACATTTTATAGTCAAAAGACGAACAAGCTCAAGAACTCAAAT ACACACTGGAATCAAACCTTGAGGATCAAACTTCCGAGAAATCCAACATCTGAATGGTTA AGGATTATAGTATACGACGCCCTACCAACCGGAGCTCCCCCTACTACCCCCAGTAGACCA AGGACAACCACTGCAAATACATCTTCATCGACACTGTCAAATTCAGGGCTAAGTTCTCAC TCTCATTCGTCGAGAAATTTGAATGTTACGTCCAAAGGTAATCAAACTTCAACATCAATT AATTCAGTATCATCTTCAGCTACACCGGCCCCTTCACATTCTTCCTCTTCTCTCTCAACA ACAGGTCCCGGGTCCACACACAAAAATAGGATTAATAGCTATCTATATTTGGGTGAAGCA AAAATTTCATTACTGGATTTATTCAAGAGGAAGGACACCACGACGAGCTATAAATTTTCA ATTGAAGCTCAGCGGTACCATCTATACGATATGAAAGGAGGGAAAGACCAAGATTCCTTG AACTGCAACTTTCTAGTGGGCGATATTTTGCTTGGATTTAAGCTAGAATGTAACGTTAAA AGAACCCCGACTTTTCAGGCTTTCAATGCTTGGAGAAATGAGTTGAACACTTACTTGGGC AGAATAGATAGAAATAAGGCCCGCATGAGATCTTCTAGTTCTTTGCCACCTCCACTAGAA GATATGTTGAGCAATAGTTCAGCTGTTAGTGGAAATGAAATACGACGCGAGAAACCATAT AGCGATACTGATCTAGCCCACGATGAAGAGGTCAATGCCGAGGATGAAATAGATGCTGAG GAATCTATTGAAGATATGAATAGCAGCGGCAGCATTTGTACGGAGAGGAGGTACGATATA GACAATGATACTATATTCGACTCTATATCTGAGGTTGTTTCGCTAAATGATGAAGAACTA GATATTCTAAATGATTTTGAAGAAGCAGATCATCCAAATGTGCCAGACATAAATGTGCAT GACATCGACGAAGATACCCGTATCAGTCTATCTTCAATGATAACAGCTTTAGATGAATAT GATATCGTAGAACCAGAAGATGTTGCAAAATTACCTGCAGTGTCGGAAAATGACATAACA TCAGTGGATGACGAAGAATCTGAAAACCAACAGGAAAGTGATGAGGAGTTTGATATATAT AATGAGGATGAGCGTGAAGATTCTGATTTTCAATCAAAAGAATACATTGGGAGTCGGCTT TTACACCTGCAAAGGGGTAAACATAATAAATCATATGCAAATTACTTATACAGAAGAGCA AAAAGTAACTTTTTTATATCGAAAAAGGAACATGCGATGGGGGTAGTATTTATGCATATT GGGGCTATCAAAAATTTACCTGCATTAAGGAATCGGTTGTCCAAGACTAATTATGAAATG GATCCATTTATCGTTATTTCGTTTGGTAGAAGAGTATTCAAGACATCTTGGAGAAAACAT ACTTTAAACCCAGAATTTAATGAATATGCCGCTTTCGAAGTTTTTCCCCATGAAACGAAT TTTGCTTTCAGTATCAAAGTTGTTGATAAAGACTCATTTTCATTCAATGATGACGTTGCA AAATGCGAACTGGCTTGGTTTGATATGCTGCAACAGCAACAACATGAAAACGAATGGATA CCTTATGAGATACCATTGGATCTCACTGTTGAGCCAGCACATGCTCCTAAGCAACCGGTA TTATATTCGAGCTTCAAATATGTTTCATATCCGTTCTTAAAAAAGAGCTTTTGGAAAGAA GCTGTTGACACATCAGTCAACTTAGAGAGACTCGACATTATTCAAGTAATGCTCTATCTT GAACGTCTTGGTTCATTCACGATGGCCGATTCTTTTGAACTCTTTCAGCATTTCAATAAA TCTGCTTGGGCCGGCCAGAGCATTACTAGATCACAATTAGTTGAAGGGCTACAGTCATGG AGAAAATCCACTAATTTTAAACGCATCTGGACATGTCCTAGATGCATGCGTTCATGCAAA CCAACTAGAAATGCTAGACGTTCTAAACTGGTTCTAGAAAATGACTTGATAACCCATTTT GCCATATGTACGTTTTCAAAAGAACACAAAACTTTAAAGCCGTCGTACGTCTCATCTGCA TTTGCATCCAAGAGATGGTTCTCTAAGGTTTTGATAAAATTAACTTATGGTAAATATGCT TTGGGATCTAACAATGCAAACATCTTGGTTCAAGACCGAGACACAGGGATAATTATTGAG GGAAAAATAAGCGCACACGTAAAGTTGGGAATGAGGATTATATACAATGGTAAAAGTCCC GAGTCTAAAAAATTTAGATCCCTCTTGAAGACTTTATCAATCAGGCAAGGCAAAAAATTT GACAGCACTGCATCTGCCAAACAAATTGAACCTTTCATAAAGTTTCACTCGCTAGACCTT TCACAATGCCGAGATAAAGATTTTAAAACATTCAATGAATTTTTTTACAGGAAACTAAAA CCAGGAAGCCGGCTGCCTGAAAGTAATAATAAAGAAATATTGTTTTCACCAGCAGATTCA AGATGCACAGTGTTCCCAACTATACAAGAATCGAAGGAAATATGGGTGAAAGGAAGAAAA TTTTCTATTAAGAAACTAGCCAATAACTATAATCCGGAAACATTTAATGACAATAACTGC AGTATTGGTATATTTAGACTGGCGCCACAAGATTATCACCGGTTTCACTCACCATGTAAT GGTACGATTGGAAAACCTGTATATGTGGATGGAGAGTATAATACTGTAAATCCAATGGCC GTTCGTAGTGAGTTAGACGTCTTTGGTGAAAATATCAGAGTTATTATCCCCATCGATTCT CCTCAATTTGGCAAACTACTGTACATACCTATTGGTGCAATGATGGTTGGATCCATACTA TTGACCTGCAAAGAAAACGATGTAGTTGAGAGTGGACAGGAGCTGGGCTATTTTAAATTT GGAGGTTCTACTATAATAATCATTATCCCGCACAACAACTTCATGTTTGATTCCGACCTT GTGAAAAACTCTTCAGAACGCATTGAAACGTTAGTCAAAGTCGGGATGAGTATAGGACAC ACATCAAATGTGAATGAATTGAAGAGAATCCGTATTAAAGTAGACGACCCAAAGAAAATT GAACGGATCAAGAGAACAATTAGTGTTAGCGATGAAAATGCCAAGAGTACAGGAAATGTA ACATGGGAATATCATACTTTACGGGAAATGATGAATAAAGATTTTGCTGGGCTATGA
Protein Properties
Pfam Domain Function
Protein Residues1138
Protein Molecular Weight130064.0
Protein Theoretical pI7.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphatidylserine decarboxylase proenzyme 2 MRIIKGRKRGKNKKPTLILKIHVIQAENIEALKTFNCNPVCFVTTNTFYSQKTNKLKNSN THWNQTLRIKLPRNPTSEWLRIIVYDALPTGAPPTTPSRPRTTTANTSSSTLSNSGLSSH SHSSRNLNVTSKGNQTSTSINSVSSSATPAPSHSSSSLSTTGPGSTHKNRINSYLYLGEA KISLLDLFKRKDTTTSYKFSIEAQRYHLYDMKGGKDQDSLNCNFLVGDILLGFKLECNVK RTPTFQAFNAWRNELNTYLGRIDRNKARMRSSSSLPPPLEDMLSNSSAVSGNEIRREKPY SDTDLAHDEEVNAEDEIDAEESIEDMNSSGSICTERRYDIDNDTIFDSISEVVSLNDEEL DILNDFEEADHPNVPDINVHDIDEDTRISLSSMITALDEYDIVEPEDVAKLPAVSENDIT SVDDEESENQQESDEEFDIYNEDEREDSDFQSKEYIGSRLLHLQRGKHNKSYANYLYRRA KSNFFISKKEHAMGVVFMHIGAIKNLPALRNRLSKTNYEMDPFIVISFGRRVFKTSWRKH TLNPEFNEYAAFEVFPHETNFAFSIKVVDKDSFSFNDDVAKCELAWFDMLQQQQHENEWI PYEIPLDLTVEPAHAPKQPVLYSSFKYVSYPFLKKSFWKEAVDTSVNLERLDIIQVMLYL ERLGSFTMADSFELFQHFNKSAWAGQSITRSQLVEGLQSWRKSTNFKRIWTCPRCMRSCK PTRNARRSKLVLENDLITHFAICTFSKEHKTLKPSYVSSAFASKRWFSKVLIKLTYGKYA LGSNNANILVQDRDTGIIIEEKISAHVKLGMRIIYNGKSPESKKFRSLLKTLSIRQGKKF DSTASAKQIEPFIKFHSLDLSQCRDKDFKTFNEFFYRKLKPGSRLPESNNKEILFSPADS RCTVFPTIQESKEIWVKGRKFSIKKLANNYNPETFNDNNCSIGIFRLAPQDYHRFHSPCN GTIGKPVYVDGEYYTVNPMAVRSELDVFGENIRVIIPIDSPQFGKLLYIPIGAMMVGSIL LTCKENDVVESGQELGYFKFGGSTIIIIIPHNNFMFDSDLVKNSSERIETLVKVGMSIGH TSNVNELKRIRIKVDDPKKIERIKRTISVSDENAKSTGNVTWEYHTLREMMNKDFAGL
References
External Links
ResourceLink
Saccharomyces Genome Database PSD2
Uniprot IDP53037
Uniprot NamePSD2_YEAST
GenBank Gene IDU19910
Genebank Protein ID841244
General Reference
  • Trotter, P. J., Pedretti, J., Yates, R., Voelker, D. R. (1995). "Phosphatidylserine decarboxylase 2 of Saccharomyces cerevisiae. Cloning and mapping of the gene, heterologous expression, and creation of the null allele." J Biol Chem 270:6071-6080.7890740
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956