Identification
Name: Glucan 1,3-beta-glucosidase 2
Synonyms
  • Exo-1,3-beta-glucanase 2
Gene Name: EXG2 Link_out
Enzyme Class:
Biological Properties
General Function: Involved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific Function: Successive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose
Cellular Location: Cell membrane; Lipid-anchor, GPI-anchor (Potential)
Pathways:
  • Starch and sucrose metabolism 00500 Link_out
  • Reactions:
    • Successive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose.
    Metabolites:
    YMDB ID Name View
    YMDB00273Alpha-D-Glucose
    YMDB00286D-Glucose
    YMDB00890water
    GO Classification:
    Component
    Not Available
    Function
    catalytic activity
    binding
    ion binding
    cation binding
    hydrolase activity
    hydrolase activity, acting on glycosyl bonds
    hydrolase activity, hydrolyzing O-glycosyl compounds
    Process
    metabolic process
    primary metabolic process
    carbohydrate metabolic process
    Gene Properties
    Chromosome Location: chromosome 4
    Locus: YDR261C Link_out
    Gene Sequence:
    >1689 bp
    ATGCCTTTGAAGTCGTTTTTTTTTTCAGCATTTCTAGTTTTATGCCTGTCTAAATTCACG
    CAAGGCGTTGGCACCACAGAGAAGGAAGAATCGTTATCGCCTTTGGAACTAAATATTTTA
    CAAAACAAATTCGCCTCCTACTATGCAAACGACACTATCACCGTGAAAGGTATTACTATT
    GGCGGCTGGCTAGTAACAGAACCTTATATCACGCCATCATTATATCGTAATGCTACGTCA
    CTGGCAAAACAGCAAAACTCTTCCAGCAATATCTCCATTGTCGACGAATTTACTCTTTGT
    AAAACCTTAGGATATAACACCTCTCTAACTTTATTGGATAATCACTTCAAAACTTGGATT
    ACAGAGGATGATTTTGAACAAATCAAAACCAACGGTTTCAATTTAGTTAGGATCCCCATC
    GGATATTGGGCGTGGAAACAAAATACTGATAAAAACTTGTACATCGATAACATAACTTTC
    AATGATCCATACGTAAGTGATGGATTACAACTGAAATATTTAAATAATGCTCTCGAATGG
    GCGCAAAAGTACGAACTAAATGTATGGTTAGATCTACATGGTGCTCCTGGATCCCAGAAT
    GGATTCGATAATTCCGGTGAAAGAATACTCTATGGCGATTTAGGCTGGTTAAGGTTGAAT
    AATACTAAAGAACTGACTCTGGCTATTTGGAGAGATATGTTCCAGACATTTTTAAATAAA
    GGTGACAAAAGTCCTGTGGTGGGTATTCAAATCGTCAACGAACCGCTTGGTGGCAAAATC
    GATGTTTCAGACATAACGGAGATGTATTACGAAGCATTTGACTTGCTCAAGAAAAATCAG
    AATTCGAGTGACAACACTACGTTTGTTATTCATGACGGTTTTCAAGGAATCGGTCACTGG
    AACTTGGAGCTAAACCCAACCTACCAGAATGTATCGCATCATTATTTCAATTTGACTGGT
    GCAAATTACAGCTCTCAAGATATATTGGTCGACCATCATCATTATGAAGTGTTTACTGAT
    GCGCAATTGGCCGAAACTCAGTTTGCACGTATTGAAAACATTATCAATTATGGGGACTCT
    ATCCACAAAGAACTTTCTTTTCACCCAGCAGTAGTCGGAGAATGGTCAGGCGCTATTACT
    GATTGTGCAACCTGGCTAAATGGTGTTGGGGTGGGTGCACGTTACGATGGATCATACTAC
    AATACAACGTTGTTTACCACCAACGACAAGCCAGTTGGAACATGTATATCCCAAAATAGC
    TTAGCTGATTGGACGCAAGATTACCGTGACCGTGTGAGACAATTCATTGAGGCACAGCTA
    GCCACTTATTCGTCAAAAACAACGGGATGGATTTTTTGGAATTGGAAGACCGAAGACGCC
    GTAGAATGGGATTATTTGAAGCTAAAAGAAGCTAACCTTTTCCCTTCCCCTTTCGACAAC
    TACACGTACTTCAAAGCAGATGGATCTATCGAAGAAAAATTCTCATCCTCTTTATCAGCA
    CAGGCATTTCCAAGAACAACGTCATCGGTTTTGTCCTCCACTACGACTTCCAGGAAGAGT
    AAGAATGCTGCAATTTCTAATAAACTAACAACTTCGCAGCTATTACCAATCAAAAATATG
    AGTTTGACCTGGAAAGCGAGCGTATGCGCACTCGCTATCACCATTGCCGCTCTTTGCGCT
    TCTCTTTAA
    Protein Properties
    Pfam Domain Function:
    Protein Residues: 562
    Protein Molecular Weight: 63507.60156
    Protein Theoretical pI: 5.01
    Signalling Regions:
    • 1-22
    Transmembrane Regions:
    • None
    Protein Sequence:
    >Glucan 1,3-beta-glucosidase 2
    MPLKSFFFSAFLVLCLSKFTQGVGTTEKEESLSPLELNILQNKFASYYANDTITVKGITI
    GGWLVTEPYITPSLYRNATSLAKQQNSSSNISIVDEFTLCKTLGYNTSLTLLDNHFKTWI
    TEDDFEQIKTNGFNLVRIPIGYWAWKQNTDKNLYIDNITFNDPYVSDGLQLKYLNNALEW
    AQKYELNVWLDLHGAPGSQNGFDNSGERILYGDLGWLRLNNTKELTLAIWRDMFQTFLNK
    GDKSPVVGIQIVNEPLGGKIDVSDITEMYYEAFDLLKKNQNSSDNTTFVIHDGFQGIGHW
    NLELNPTYQNVSHHYFNLTGANYSSQDILVDHHHYEVFTDAQLAETQFARIENIINYGDS
    IHKELSFHPAVVGEWSGAITDCATWLNGVGVGARYDGSYYNTTLFTTNDKPVGTCISQNS
    LADWTQDYRDRVRQFIEAQLATYSSKTTGWIFWNWKTEDAVEWDYLKLKEANLFPSPFDN
    YTYFKADGSIEEKFSSSLSAQAFPRTTSSVLSSTTTSRKSKNAAISNKLTTSQLLPIKNM
    SLTWKASVCALAITIAALCASL
    References
    External Links:
    Resource Link
    Saccharomyces Genome Database: EXG2 Link_out
    Uniprot ID: P52911 Link_out
    Uniprot Name: EXG2_YEAST Link_out
    GenBank Gene ID: Z46870 Link_out
    Genebank Protein ID: 861117 Link_out
    General Reference:
    • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78. Pubmed: 9169867 Link_out
    • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741. Pubmed: 14562106 Link_out