You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucan 1,3-beta-glucosidase 2
Synonyms
  • Exo-1,3-beta-glucanase 2
Gene NameEXG2
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific FunctionSuccessive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose
Cellular LocationCell membrane; Lipid-anchor, GPI-anchor (Potential)
Pathways
  • Starch and sucrose metabolism00500
Reactions
  • Successive hydrolysis of beta-D-glucose units from the non-reducing ends of (1->3)-beta-D-glucans, releasing alpha-glucose.
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00286D-GlucoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
ion binding
cation binding
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
binding
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR261C
Gene Sequence
>1689 bp
ATGCCTTTGAAGTCGTTTTTTTTTTCAGCATTTCTAGTTTTATGCCTGTCTAAATTCACG
CAAGGCGTTGGCACCACAGAGAAGGAAGAATCGTTATCGCCTTTGGAACTAAATATTTTA
CAAAACAAATTCGCCTCCTACTATGCAAACGACACTATCACCGTGAAAGGTATTACTATT
GGCGGCTGGCTAGTAACAGAACCTTATATCACGCCATCATTATATCGTAATGCTACGTCA
CTGGCAAAACAGCAAAACTCTTCCAGCAATATCTCCATTGTCGACGAATTTACTCTTTGT
AAAACCTTAGGATATAACACCTCTCTAACTTTATTGGATAATCACTTCAAAACTTGGATT
ACAGAGGATGATTTTGAACAAATCAAAACCAACGGTTTCAATTTAGTTAGGATCCCCATC
GGATATTGGGCGTGGAAACAAAATACTGATAAAAACTTGTACATCGATAACATAACTTTC
AATGATCCATACGTAAGTGATGGATTACAACTGAAATATTTAAATAATGCTCTCGAATGG
GCGCAAAAGTACGAACTAAATGTATGGTTAGATCTACATGGTGCTCCTGGATCCCAGAAT
GGATTCGATAATTCCGGTGAAAGAATACTCTATGGCGATTTAGGCTGGTTAAGGTTGAAT
AATACTAAAGAACTGACTCTGGCTATTTGGAGAGATATGTTCCAGACATTTTTAAATAAA
GGTGACAAAAGTCCTGTGGTGGGTATTCAAATCGTCAACGAACCGCTTGGTGGCAAAATC
GATGTTTCAGACATAACGGAGATGTATTACGAAGCATTTGACTTGCTCAAGAAAAATCAG
AATTCGAGTGACAACACTACGTTTGTTATTCATGACGGTTTTCAAGGAATCGGTCACTGG
AACTTGGAGCTAAACCCAACCTACCAGAATGTATCGCATCATTATTTCAATTTGACTGGT
GCAAATTACAGCTCTCAAGATATATTGGTCGACCATCATCATTATGAAGTGTTTACTGAT
GCGCAATTGGCCGAAACTCAGTTTGCACGTATTGAAAACATTATCAATTATGGGGACTCT
ATCCACAAAGAACTTTCTTTTCACCCAGCAGTAGTCGGAGAATGGTCAGGCGCTATTACT
GATTGTGCAACCTGGCTAAATGGTGTTGGGGTGGGTGCACGTTACGATGGATCATACTAC
AATACAACGTTGTTTACCACCAACGACAAGCCAGTTGGAACATGTATATCCCAAAATAGC
TTAGCTGATTGGACGCAAGATTACCGTGACCGTGTGAGACAATTCATTGAGGCACAGCTA
GCCACTTATTCGTCAAAAACAACGGGATGGATTTTTTGGAATTGGAAGACCGAAGACGCC
GTAGAATGGGATTATTTGAAGCTAAAAGAAGCTAACCTTTTCCCTTCCCCTTTCGACAAC
TACACGTACTTCAAAGCAGATGGATCTATCGAAGAAAAATTCTCATCCTCTTTATCAGCA
CAGGCATTTCCAAGAACAACGTCATCGGTTTTGTCCTCCACTACGACTTCCAGGAAGAGT
AAGAATGCTGCAATTTCTAATAAACTAACAACTTCGCAGCTATTACCAATCAAAAATATG
AGTTTGACCTGGAAAGCGAGCGTATGCGCACTCGCTATCACCATTGCCGCTCTTTGCGCT
TCTCTTTAA
Protein Properties
Pfam Domain Function
Protein Residues562
Protein Molecular Weight63507.60156
Protein Theoretical pI5.01
Signalling Regions
  • 1-22
Transmembrane Regions
  • None
Protein Sequence
>Glucan 1,3-beta-glucosidase 2
MPLKSFFFSAFLVLCLSKFTQGVGTTEKEESLSPLELNILQNKFASYYANDTITVKGITI
GGWLVTEPYITPSLYRNATSLAKQQNSSSNISIVDEFTLCKTLGYNTSLTLLDNHFKTWI
TEDDFEQIKTNGFNLVRIPIGYWAWKQNTDKNLYIDNITFNDPYVSDGLQLKYLNNALEW
AQKYELNVWLDLHGAPGSQNGFDNSGERILYGDLGWLRLNNTKELTLAIWRDMFQTFLNK
GDKSPVVGIQIVNEPLGGKIDVSDITEMYYEAFDLLKKNQNSSDNTTFVIHDGFQGIGHW
NLELNPTYQNVSHHYFNLTGANYSSQDILVDHHHYEVFTDAQLAETQFARIENIINYGDS
IHKELSFHPAVVGEWSGAITDCATWLNGVGVGARYDGSYYNTTLFTTNDKPVGTCISQNS
LADWTQDYRDRVRQFIEAQLATYSSKTTGWIFWNWKTEDAVEWDYLKLKEANLFPSPFDN
YTYFKADGSIEEKFSSSLSAQAFPRTTSSVLSSTTTSRKSKNAAISNKLTTSQLLPIKNM
SLTWKASVCALAITIAALCASL
References
External Links
ResourceLink
Saccharomyces Genome Database EXG2
Uniprot IDP52911
Uniprot NameEXG2_YEAST
GenBank Gene IDZ46870
Genebank Protein ID861117
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106