You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePyruvate kinase 2
Synonyms
  • PK 2
Gene NamePYK2
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionMay be used by cells under conditions in which the level of glycolytic flux is very low
Cellular LocationNot Available
SMPDB Pathways
Ethanol fermentationPW002448 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
Purine metabolismec00230 Map00230
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Adenosine triphosphate + Pyruvic acidADP + Phosphoenolpyruvic acid
KEGG Reactions
Phosphoenolpyruvic acid + hydron + ADPPyruvic acid + Adenosine triphosphate
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00175Pyruvic acidShow
YMDB00276Phosphoenolpyruvic acidShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring phosphorus-containing groups
magnesium ion binding
binding
ion binding
cation binding
alkali metal ion binding
metal ion binding
potassium ion binding
kinase activity
pyruvate kinase activity
catalytic activity
Process
monosaccharide metabolic process
metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
small molecule metabolic process
alcohol metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR347C
Gene Sequence>1521 bp ATGCCAGAGTCCAGATTGCAGAGACTAGCTAATTTGAAAATAGGAACTCCGCAGCAGCTC AGACGCACCTCCATAATAGGTACCATTGGGCCCAAGACAAATAGCTGCGAGGCCATTACT GCTCTGAGAAAAGCTGGTTTGAACATCATTCGATTGAACTTTTCCCATGGCTCCTACGAA TTCCATCAATCAGTAATCGAAAATGCTGTGAAATCGGAACAGCAATTCCCTGGCAGGCCG CTCGCCATTGCCCTGGATACCAAGGGTCCCGAGATCAGAACAGGTCGCACGTTAAATGAC CAAGATCTTTATATCCCCGTAGACCACCAAATGATCTTTACCACTGACGCAAGTTTTGCA AACACCTCCAATGATAAAATCATGTATATAGACTATGCTAACCTGACAAAAGTTATCGTT CCGGGGAGATTTATATACGTGGACGACGGGATTCTCTCTTTTAAAGTGCTCCAAATCATT GACGAATCTAATTTAAGGGTGCAAGCGGTAAACTCGGGTTATATCGCATCTCATAAAGGT GTTAATCTGCCTAATACCGACGTTGATTTGCCCCCCTTGTCCGCCAAAGACATGAAGGAC TTGCAATTCGGAGTCCGCAATGGCATTCACATCGTATTTGCCTCTTTCATAAGAACTTCA GAAGATGTGTTGTCTATCAGAAAAGCGTTGGGTTCTGAAGGGCAAGATATCAAGATTATA TCCAAGATAGAAAACCAGCAAGGGTTGGATAATTTTGACGAAATCCTGGAAGTCACGGAT GGTGTTATGATAGCGAGAGGCGATTTAGGAATTGAAATCCTGGCACCTGAAGTATTAGCC ATTCAAAAAAAGCTGATTGCAAAATGTAATTTGGCGGGCAAACCTGTCATTTGCGCGACT CAGATGCTGGATTCAATGACACACAATCCGAGACCGACAAGGGCTGAAGTATCGGATGTG GGTAACGCTGTGTTGGATGGTGCTGATTGTGTTATGCTTTCTGGAGAAACGGCGAAGGGT GATTATCCGGTGAATGCAGTTAATATTATGGCGGCGACCGCTCTGATTGCTGAAAGTACT ATCGCTCATTTGGCTCTTTATGACGATCTCAGAGACGCCACTCCCAAACCTACTTCCACT ACGGAAACTGTAGCAGCTGCAGCTACCGCAGCAATCTTGGAGCAAGATGGTAAGGCCATC GTTGTATTATCTACTACAGGGAACACGGCAAGGCTACTGTCGAAGTATAGACCAAGCTGC CCTATCATATTAGTAACAAGACACGCAAGAACGGCAAGAATTGCGCATTTGTATAGAGGT GTTTTCCCATTTCTGTATGAACCGAAACGCCTAGACGACTGGGGTGAGGATGTTCATAGG CGCCTAAAGTTTGGTGTTGAAATGGCGAGGTCTTTCGGAATGGTGGACAACGGTGATACT GTTGTTTCCATTCAAGGATTCAAAGGAGGAGTCGGCCATTCCAATACCTTACGCATTTCT ACTGTTGGTCAAGAATTCTAG
Protein Properties
Pfam Domain Function
Protein Residues506
Protein Molecular Weight55194.69922
Protein Theoretical pI6.91
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pyruvate kinase 2 MPESRLQRLANLKIGTPQQLRRTSIIGTIGPKTNSCEAITALRKAGLNIIRLNFSHGSYE FHQSVIENAVKSEQQFPGRPLAIALDTKGPEIRTGRTLNDQDLYIPVDHQMIFTTDASFA NTSNDKIMYIDYANLTKVIVPGRFIYVDDGILSFKVLQIIDESNLRVQAVNSGYIASHKG VNLPNTDVDLPPLSAKDMKDLQFGVRNGIHIVFASFIRTSEDVLSIRKALGSEGQDIKII SKIENQQGLDNFDEILEVTDGVMIARGDLGIEILAPEVLAIQKKLIAKCNLAGKPVICAT QMLDSMTHNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGDYPVNAVNIMAATALIAEST IAHLALYDDLRDATPKPTSTTETVAAAATAAILEQDGKAIVVLSTTGNTARLLSKYRPSC PIILVTRHARTARIAHLYRGVFPFLYEPKRLDDWGEDVHRRLKFGVEMARSFGMVDNGDT VVSIQGFKGGVGHSNTLRISTVGQEF
References
External Links
ResourceLink
Saccharomyces Genome Database PYK2
Uniprot IDP52489
Uniprot NameKPYK2_YEAST
GenBank Gene IDX95720
Genebank Protein ID1199849
General Reference
  • Purnelle, B., Goffeau, A. (1996). "Nucleotide sequence analysis of a 40 kb segment on the right arm of yeast chromosome XV reveals 18 open reading frames including a new pyruvate kinase and three homologues to chromosome I genes." Yeast 12:1475-1481.8948102
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Boles, E., Schulte, F., Miosga, T., Freidel, K., Schluter, E., Zimmermann, F. K., Hollenberg, C. P., Heinisch, J. J. (1997). "Characterization of a glucose-repressed pyruvate kinase (Pyk2p) in Saccharomyces cerevisiae that is catalytically insensitive to fructose-1,6-bisphosphate." J Bacteriol 179:2987-2993.9139918
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106