You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6,7-dimethyl-8-ribityllumazine synthase
Synonyms
  • DMRL synthase
  • Lumazine synthase
  • Riboflavin synthase beta chain
Gene NameRIB4
Enzyme Class
Biological Properties
General FunctionInvolved in riboflavin biosynthetic process
Specific FunctionCondensation of 5-amino-6-(1'-D)-ribityl-amino- 2,4(1H,3H)-pyrimidinedione with L-3,4-dihydroxy-2-butanone 4- phosphate to produce 6,7-dimethyl-8-(1-D-ribityl)lumazine
Cellular LocationNot Available
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
2-Hydroxy-3-oxobutyl phosphate + 5-Amino-6-ribitylamino uracil6,7-Dimethyl-8-(1-D-ribityl)lumazine
KEGG Reactions
5-Amino-6-ribitylamino uracil + 2-Hydroxy-3-oxobutyl phosphatewater + 6,7-Dimethyl-8-(1-D-ribityl)lumazine + phosphate
Metabolites
YMDB IDNameView
YMDB001715-Amino-6-ribitylamino uracilShow
YMDB004562-Hydroxy-3-oxobutyl phosphateShow
YMDB00534RiboflavinShow
YMDB007655-Amino-6-(D-ribitylamino)uracilShow
YMDB007666,7-Dimethyl-8-(1-D-ribityl)lumazineShow
YMDB00890waterShow
GO Classification
Component
macromolecular complex
protein complex
riboflavin synthase complex
Function
Not Available
Process
nitrogen compound metabolic process
riboflavin metabolic process
riboflavin biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL143C
Gene Sequence>510 bp ATGGCAGTTAAAGGATTAGGCAAACCAGATCAAGTTTATGACGGTTCCAAAATCAGGGTC GGTATCATTCATGCCCGTTGGAACCGTGTCATTATTGACGCTCTTGTGAAAGGTGCTATT GAAAGAATGGCTTCCCTTGGTGTCGAGGAAAATAACATAATAATTGAAACTGTTCCTGGA TCCTATGAATTACCTTGGGGGACAAAAAGGTTTGTTGACAGACAAGCGAAGTTGGGAAAG CCGCTAGATGTTGTAATTCCTATTGGTGTACTTATCAAAGGTAGTACAATGCACTTTGAA TACATTTCAGATTCCACCACTCACGCATTGATGAACTTACAAGAAAAAGTCGACATGCCC GTCATTTTTGGCCTCTTAACTTGCATGACTGAAGAACAAGCCCTGGCCAGAGCTGGCATC GATGAAGCGCACTCCATGCACAACCATGGTGAAGATTGGGGTGCTGCAGCAGTGGAAATG GCTGTTAAGTTCGGTAAAAATGCTTTTTGA
Protein Properties
Pfam Domain Function
Protein Residues169
Protein Molecular Weight18555.40039
Protein Theoretical pI6.51
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6,7-dimethyl-8-ribityllumazine synthase MAVKGLGKPDQVYDGSKIRVGIIHARWNRVIIDALVKGAIERMASLGVEENNIIIETVPG SYELPWGTKRFVDRQAKLGKPLDVVIPIGVLIKGSTMHFEYISDSTTHALMNLQEKVDMP VIFGLLTCMTEEQALARAGIDEAHSMHNHGEDWGAAAVEMAVKFGKNAF
References
External Links
ResourceLink
Saccharomyces Genome Database RIB4
Uniprot IDP50861
Uniprot NameRIB4_YEAST
GenBank Gene IDAY558430
Genebank Protein ID45270750
PDB ID
1EJB
General Reference
  • Garcia-Ramirez, J. J., Santos, M. A., Revuelta, J. L. (1995). "The Saccharomyces cerevisiae RIB4 gene codes for 6,7-dimethyl-8-ribityllumazine synthase involved in riboflavin biosynthesis. Molecular characterization of the gene and purification of the encoded protein." J Biol Chem 270:23801-23807.7559556
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Meining, W., Mortl, S., Fischer, M., Cushman, M., Bacher, A., Ladenstein, R. (2000). "The atomic structure of pentameric lumazine synthase from Saccharomyces cerevisiae at 1.85 A resolution reveals the binding mode of a phosphonate intermediate analogue." J Mol Biol 299:181-197.10860731