You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenosylmethionine-8-amino-7-oxononanoate aminotransferase
Synonyms
  • 7,8-diamino-pelargonic acid aminotransferase
  • DAPA AT
  • DAPA aminotransferase
  • Diaminopelargonic acid synthase
Gene NameBIO3
Enzyme Class
Biological Properties
General FunctionInvolved in transaminase activity
Specific FunctionCatalyzes the transfer of the alpha-amino group from S- adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only animotransferase known to utilize SAM as an amino donor
Cellular LocationNot Available
SMPDB Pathways
Biotin BiosynthesisPW002380 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biotin metabolismec00780 Map00780
SMPDB Reactions
8-Amino-7-oxononanoic acid + S-Adenosyl-L-methionineDiaminopimelic acid + S-adenosyl-4-methylthio-2-oxobutanoate
KEGG Reactions
8-Amino-7-oxononanoic acid + S-AdenosylmethionineS-adenosyl-4-methylthio-2-oxobutanoic acid + 7,8-diaminononanoic acid
Metabolites
YMDB IDNameView
YMDB001027,8-diaminononanoic acidShow
YMDB00250S-adenosyl-4-methylthio-2-oxobutanoic acidShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB009058-Amino-7-oxononanoic acidShow
YMDB01063S-adenosyl-4-methylthio-2-oxobutanoateShow
YMDB16140Diaminopimelic acidShow
GO Classification
Component
Not Available
Function
adenosylmethionine-8-amino-7-oxononanoate transaminase activity
catalytic activity
transferase activity
binding
transferase activity, transferring nitrogenous groups
transaminase activity
cofactor binding
pyridoxal phosphate binding
Process
vitamin metabolic process
water-soluble vitamin metabolic process
biotin metabolic process
biotin biosynthetic process
metabolic process
small molecule metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNR058W
Gene Sequence>1443 bp ATGTCCCAAGAAATTTCATATACACCAGATGTCGCGGAACTGCTAGACTTTGATAAAAAA CATATTTGGCATCCTTATACGTCATTGAGTTCACCATTGAACGTTTATCCGGTAAAGAGT GCTCACGGATGCAAGCTGGTGTTGGATACCGACTCACCAGTGGACGTCGAGGTGATCGAC GCCATGTCGTCGTGGTGGTGTGTTATTCACGGGTACAATAATCCAGAATTAAATGAGGCC CTTACCAAGCAGATGTTAAAGTTTTCTCACGTCCTTCTTGGTGGATTCACCCATAAAGGA GCTGTGAATCTAGTCCAAAAACTTTTAAAAGTGATTGATGAACCCTCTTTGCAGTACTGT TTCCTCGCAGATTCTGGCTCAGTAGCAGTGGAAGTAGCTTTGAAGATGGCTTTACAATCA AACATGTCAGGGGAAGCTACTAAAAATAGAACAAAATTTTTGACAATCAAGAACGGGTAT CATGGTGATACATTTGGCGCTATGAGTGTTTGTGATCCTGAGAATTCTATGCATCATATC TACAACGATCGACTCAGTGAGAACATCTTCGCCCAAGCTCCCTCTATTGTCGATGGTCTT CCAACCAGCCAGAACGGTTTCGAGGACCATTGGAATGCAGAAGAAGTTACCGATCTCAAG AAGCAATTTGAATTGCATAGTGATGAGATCTGTGCTGTGATTTTGGAGCCTATCTTACAG GGTGCAGGAGGTTTGCGACCATACCATCCACAGTTCCTAATTGAAGTTCAGAAACTATGT AACCAATACGACGTTTTATTCATCATGGACGAGATTGCTACGGGATTTGGTAGAACAGGT GAGATTTTCGCATTCAAGCACTGTCAAAAATACCAGGACCAACGTGGCATCAGTCCTTCC GATCAGATCAAAGTTGTTCCTGACATATTGTGCGTTGGGAAGGGCTTAACCAGTGGATAT ATGACTATGAGTGCAGTGGTAGTCAACGACAAAGTTGCTTCCAGAATCTCTTCTCCAAAT AGCCCTACTGGTGGCTGCTTCATGCATGGCCCCACCTTCATGGGCAATGCCCTGGCATGC AGTGTGGCAGAAAAGTCTATGGATATACTACTGCGTGGCGAGTGGAGAAAACAAGTGTCT GCAATTGAAGACCAAATTTATAGAGAACTATACCAGTACATCAAGAACCCAGATAATGGG CTCATTGGAACTGTTGTTAAGCGTGTGTCAGTTATTGGAGCTGTAGGTATCGTAGAGCTA TACAAGAAGACAGATCCCGAGTGGTTCCAGAAAAAGTTTATATCCAAGGGAGTACATATC CGACCTTTCAACTGCCTGTGTTACATTATGCCACCATATGTGATCACGACAGAGGAATTG ACGAAGGTTAATCAAGTCTTGATTGAAGTATTACATGAGTGGAAATCCCACATAAACCAA TGA
Protein Properties
Pfam Domain Function
Protein Residues480
Protein Molecular Weight53708.39844
Protein Theoretical pI6.41
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenosylmethionine-8-amino-7-oxononanoate aminotransferase MSQEISYTPDVAELLDFDKKHIWHPYTSLSSPLNVYPVKSAHGCKLVLDTDSPVDVEVID AMSSWWCVIHGYNNPELNEALTKQMLKFSHVLLGGFTHKGAVNLVQKLLKVIDEPSLQYC FLADSGSVAVEVALKMALQSNMSGEATKNRTKFLTIKNGYHGDTFGAMSVCDPENSMHHI YNDRLSENIFAQAPSIVDGLPTSQNGFEDHWNAEEVTDLKKQFELHSDKICAVILEPILQ GAGGLRPYHPQFLIEVQKLCNQYDVLFIMDEIATGFGRTGEIFAFKHCQKYQDQHGISPS DQIKVVPDILCVGKGLTSGYMTMSAVVVNDKVASRISSPNSPTGGCFMHGPTFMGNALAC SVAEKSMDILLRGEWRKQVSAIENQIYRELYQYIKNPDNGLIGTVVKRVSVIGAVGIVEL YKKTDPEWFQKKFISKGVHIRPFNCLCYIMPPYVITTEELTKVNQVLIEVLHEWKSHINQ
References
External Links
ResourceLink
Saccharomyces Genome Database BIO3
Uniprot IDP50277
Uniprot NameBIOA_YEAST
GenBank Gene IDAB200248
Genebank Protein ID67772574
General Reference
  • Phalip, V., Kuhn, I., Lemoine, Y., Jeltsch, J. M. (1999). "Characterization of the biotin biosynthesis pathway in Saccharomyces cerevisiae and evidence for a cluster containing BIO5, a novel gene involved in vitamer uptake." Gene 232:43-51.10333520
  • Wu, H., Ito, K., Shimoi, H. (2005). "Identification and characterization of a novel biotin biosynthesis gene in Saccharomyces cerevisiae." Appl Environ Microbiol 71:6845-6855.16269718
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873