You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLactoylglutathione lyase
Synonyms
  • Aldoketomutase
  • Glyoxalase I
  • Glx I
  • Ketone-aldehyde mutase
  • Methylglyoxalase
  • S-D-lactoylglutathione methylglyoxal lyase
Gene NameGLO1
Enzyme Class
Biological Properties
General FunctionInvolved in lactoylglutathione lyase activity
Specific FunctionCatalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione
Cellular LocationNot Available
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Glutathione + PyruvaldehydeS-Lactoylglutathione
KEGG Reactions
Pyruvaldehyde + GlutathioneS-Lactoylglutathione
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
YMDB00170PyruvaldehydeShow
YMDB00246S-LactoylglutathioneShow
GO Classification
Component
Not Available
Function
lyase activity
binding
ion binding
cation binding
metal ion binding
carbon-sulfur lyase activity
lactoylglutathione lyase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 13
LocusYML004C
Gene Sequence>981 bp ATGTCCACTGATAGTACACGCTATCCAATTCAGATTGAGAAAGCCTCGAATGATCCAACC CTTCTGCTTAATCACACATGTTTAAGAGTCAAGGATCCAGCAAGGGCTGTTAAGTTCTAC ACCGAACACTTCGGTATGAAGCTATTAAGCAGAAAGGATTTTGAAGAAGCAAAATTTAGC TTGTACTTTTTAAGCTTTCCAAAAGACGACATACCCAAAAATAAGAATGGAGAGCCTGAT GTTTTTAGCGCACACGGTGTCTTAGAACTAACTCACAATTGGGGTACTGAAAAAAACCCA GACTACAAGATCAACAACGGGAATGAGGAACCTCATCGTGGATTTGGGCACATCTGTTTT TCTGTATCCGATATCAATAAAACCTGCGAAGAGCTAGAATCTCAGGGTGTCAAATTCAAG AAGAGACTCTCTGAAGGAAGACAGAAGGACATTGCGTTTGCTTTAGACCCTGATGGATAC TGGATTGAGTTGATCACATATTCTAGAGAGGGTCAGGAATACCCAAAGGGCTCAGTAGGT AACAAGTTCAATCATACCATGATTCGTATTAAAAACCCAACCCGGTCTTTAGAATTCTAC CAGAATGTGTTGGGCATGAAATTATTAAGAACTAGTGAGCACGAAAGTGCAAAATTTACG TTATACTTTCTTGGTTATGGCGTTCCAAAGACCGACAGCGTTTTTTCATGTGAAAGTGTG TTGGAGTTAACTCATAATTGGGGAACTGAGAATGATCCAAACTTCCACTATCATAACGGT AACTCAGAGCCCCAGGGTTATGGTCACATCTGCATAAGTTGCGATGACGCTGGCGCCCTT TGTAAAGAAATTGAAGTGAAATACGGCGATAAGATCCAATGGTCTCCTAAATTTAACCAA GGCAGAATGAAGAATATTGCCTTTTTGAAGGATCCTGATGGTTATTCCATTGAAGTCGTT CCTTATGGTTTGATTGCCTAA
Protein Properties
Pfam Domain Function
Protein Residues326
Protein Molecular Weight37208.69922
Protein Theoretical pI6.84
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Lactoylglutathione lyase MSTDSTRYPIQIEKASNDPTLLLNHTCLRVKDPARTVKFYTEHFGMKLLSRKDFEEAKFS LYFLSFPKDDIPKNKNGEPDVFSAHGVLELTHNWGTEKNPDYKINNGNEEPHRGFGHICF SVSDINKTCEELESQGVKFKKRLSEGRQKDIAFALGPDGYWIELITYSREGQEYPKGSVG NKFNHTMIRIKNPTRSLEFYQNVLGMKLLRTSEHESAKFTLYFLGYGVPKTDSVFSCESV LELTHNWGTENDPNFHYHNGNSEPQGYGHICISCDDAGALCKEIEVKYGDKIQWSPKFNQ GRMKNIAFLKDPDGYSIEVVPHGLIA
References
External Links
ResourceLink
Saccharomyces Genome Database GLO1
Uniprot IDP50107
Uniprot NameLGUL_YEAST
GenBank Gene IDAJ297938
Genebank Protein ID11182130
General Reference
  • Inoue, Y., Kimura, A. (1996). "Identification of the structural gene for glyoxalase I from Saccharomyces cerevisiae." J Biol Chem 271:25958-25965.8824231
  • Frickel, E. M., Jemth, P., Widersten, M., Mannervik, B. (2001). "Yeast glyoxalase I is a monomeric enzyme with two active sites." J Biol Chem 276:1845-1849.11050082
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Inoue, Y., Yano, H., Ginya, H., Tsuchiyama, H., Murata, K., Kimura, A. (1991). "Positive effect of GAC gene product on the mRNA level of glyoxalase I gene in Saccharomyces cerevisiae." Biotechnol Appl Biochem 14:391-394.1777125
  • Ridderstrom, M., Mannervik, B. (1996). "The primary structure of monomeric yeast glyoxalase I indicates a gene duplication resulting in two similar segments homologous with the subunit of dimeric human glyoxalase I." Biochem J 316 ( Pt 3):1005-1006.8670139
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106